KEGG   Agrobacterium fabrum: Atu6167
Entry
Atu6167           CDS       T00070                                 
Symbol
virB1
Name
(GenBank) component of type IV secretion system
  KO
K03194  type IV secretion system protein VirB1
Organism
atu  Agrobacterium fabrum
Pathway
atu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:atu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Atu6167 (virB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:atu02044]
    Atu6167 (virB1)
Secretion system [BR:atu02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Atu6167 (virB1)
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-ProteinID: AAK90928
UniProt: P17791
Position
Ti:183877..184614
AA seq 245 aa
MLKATGPLSIILLASTCPSSGAAPLSFAEFNNFARECAPSVAPSTLAAIAQVESRFDPLA
VHDNTTGETLHWQNQAQATQVVMDRLEARHSLDVGLMQINSRNFSVLGLTPDGALQPCTS
LSVAANLLGSRYAGGNTADDEQLSLRRAISAYNTGDFTHGFANGYVRKVETAAQQLVPPL
TARPKDDREKPGSEETWDVWGAYKRRSPEGGAGGSSGPPPPPDEDNRKSEDDDQLLFDLN
QGGPQ
NT seq 738 nt   +upstreamnt  +downstreamnt
atgttgaaggcaacagggccgctgtcgattatcttactggcctccacgtgcccgtcgagt
ggtgctgccccactttcatttgctgagttcaataattttgcacgcgaatgcgctccatcc
gttgctccatctacgcttgcagcgatcgctcaggtcgaaagtcgctttgatccgcttgct
gtgcatgacaataccaccggcgaaacgcttcactggcagaaccaggctcaagcaacgcaa
gtcgtgatggaccgtctcgaagcacggcattcgctggatgttgggctcatgcagatcaat
tcccggaatttttccgtgctcggtctgacacctgacggagcccttcaaccttgcacgtca
ttatctgtcgccgcaaacttgcttgggagccgctacgctggcggcaacacggctgacgac
gagcaattgtcgcttcgtcgggcaatctccgcctataacaccggtgatttcacgcacggc
ttcgcgaacggctacgtgcgaaaagttgaaacggccgctcaacagctcgtccccccgtta
accgcgcgtccaaaagatgatcgtgagaagccgggatccgaggaaacatgggatgtttgg
ggggcatataagcgtcgttccccggagggcggagctggcgggtcatccggtccgcctccg
ccgccagacgaggacaaccgcaaatccgaagacgacgatcaactcttgttcgacttaaat
caaggaggtccgcaataa

DBGET integrated database retrieval system