KEGG   Agrobacterium fabrum: Atu6171
Entry
Atu6171           CDS       T00070                                 
Symbol
virB5
Name
(GenBank) component of type IV secretion system
  KO
K03200  type IV secretion system protein VirB5
Organism
atu  Agrobacterium fabrum
Pathway
atu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:atu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Atu6171 (virB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:atu02044]
    Atu6171 (virB5)
Secretion system [BR:atu02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Atu6171 (virB5)
SSDB
Motif
Pfam: DUF4141
Other DBs
NCBI-ProteinID: AAK90933
UniProt: P17795
Position
Ti:187691..188353
AA seq 220 aa
MKIMQLVAAAMAVSLLSVGPARAQFVVSDPATEAETLATALETAANLEQTITMVAMLTSA
YGVTGLLTSLNQKNQYPSTRDLDTEMFSPRMPMSTTARAITTDTDRAVVGGDAEADLLRS
QITGSANSAGIAADNLETMDKRLTANAETSTQLSRSRNIMQATVTNGLLLKQIHDAMIQN
VQATSLLTMTTAQAGLHEAEEAAAQRKEHQKTAVIFGAVP
NT seq 663 nt   +upstreamnt  +downstreamnt
atgaagatcatgcaacttgttgctgcggccatggccgtcagccttctttcggtcgggccc
gcgcgggcgcagttcgttgtcagcgatccggcgacggaagctgagacgctggcgacggcg
ctcgagactgcggcaaatctcgaacagaccataacgatggtggcgatgttaacctcggct
tatggcgtcaccggcctactaacttcgctcaaccaaaaaaatcagtatccctcgaccagg
gacttggacacggaaatgttttcgccgcgaatgccaatgtcgaccacggcacgtgcgatc
accaccgatacagatcgcgccgtagttggtggcgacgctgaagcggatctgttgcgatcg
cagatcaccggttccgcaaatagcgcgggcattgcggctgacaacctggagacgatggac
aaacgcttaacagcgaatgccgagacctcgacacagctttctcgctctcgcaatatcatg
caggcaaccgttaccaacggtttgcttctcaagcagatccatgacgcaatgattcaaaat
gtacaggcgaccagcttgttaacgatgaccaccgcgcaggctggccttcatgaggcggaa
gaggcggccgctcaacgtaaggagcatcaaaagactgcggtcatctttggggccgtcccc
tga

DBGET integrated database retrieval system