KEGG   Azoarcus sp. SY39: C0099_03725Help
Entry
C0099_03725       CDS       T05265                                 

Gene name
putA
Definition
(GenBank) trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
atw  Azoarcus sp. SY39
Pathway
atw00250  Alanine, aspartate and glutamate metabolism
atw00330  Arginine and proline metabolism
atw01100  Metabolic pathways
atw01110  Biosynthesis of secondary metabolites
atw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:atw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C0099_03725 (putA)
   00330 Arginine and proline metabolism
    C0099_03725 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:atw03000]
    C0099_03725 (putA)
Enzymes [BR:atw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     C0099_03725 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     C0099_03725 (putA)
Transcription factors [BR:atw03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    C0099_03725 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AUN94128
UniProt: A0A2I6S4G2
Position
772467..776099
Genome map
AA seq 1210 aa AA seqDB search
MPDRSVARLLCIESPPAGTRAAIDGALRPPESEYVAALLAAWAPSPDEVARIAELAPRLA
AAQRMRRMRAGGVDALMREFSLSSDEGLALMCLAEALLRVPDAATVDRLIRDRLAAGDWR
AHVGHDPSLFVNAAAWGLLAGRRLLAPADEHGLARALHEALARGGEPLLRGAMRGAMRLL
GERFVVGRDIGEALRRAARARPCLYSFDMLGEAAMTDADARVYLAAYLAAARAIGEAAGA
RHCDESDGMSVKLSALSPRYVWSQPERLREELLPRLASVCHVAAEAGIGLAIDAEEADRL
EPSLDLFEALLDDPRLAGWDGLGFVVQAYQKRAPALVDRLVELARMRGRRITVRLVKGAY
WDTEIKRAQLDGVDDYPVFTRKAHTDLSWLVCARRLLAARAWLRPQFATHNAHSVAAVLA
MAGDARDFEFQCLHGMGEALYDGLLAEPDVARTVRVYGPVGSHETLLPYLVRRLLENGAN
SSFVHGIVDPGVPLDTLLADPAECARAAGGRPHPRIATPPDLYGPTRRNPSGIDLASPGV
RASLAARVAAELGRRHVASPLLAVEHAGGPRRTVRNPAALGDVVGEVEECVPDAVPTAVE
AALREGREWGAVPATRRAAVLEAAGDVLEADAGRLLPLLVREAGKTWHAAIAELREAVDF
CRYYANAARALDMDARPLGAVVCISPWNFPLAIFTGQIAGALAAGNAVLAKPAEQTPLIA
FAATRAMHAAGVPRAALQLLPEKGATVGAALVADARIGGVLFTGSTATAGSIRRVLAARD
DEPLLICETGGQNALVADSTALPEQLVADVIASAFDSAGQRCSALRLLCVQEDIADRVLE
MLRGAVAERVLGDPRDARTDIGPVIDAAARDRIEDWIASVRRRGLDVWRAPLQVPDGGHF
VVPTIIAIDDPALLAEEHFGPVLHVLRVPADGIEAAIEQVNALGFGLTFGVHSRIGTSVA
RFALLARAGNVYVNRNIVGAVVGVQPFGGHGRSGTGPKAGGPLYVPRLARGAGLPALDFA
RAPQLSQAFTDLLDWIACGSGALASDARGELLVAGRVYAAETLSAGELSLPGPTGEDNRL
YFVPVGVVTCVAAHAGALLHQMLAAFAGGNEVRVARDAMSARVLASLPATVVRGAAHGDD
VRDCAAVLFDGPDALARQWRERLATLDPAPELLRPRPRYALNRLVRERCVSINTAAAGGN
AALFALGGGA
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatcgaagcgtcgcccggctgctgtgcatcgaatccccgccggcaggcacgcgc
gccgcgatcgatggcgcgttgcgtccgcccgagagcgagtatgtcgcggcgctgctcgcc
gcgtgggctccgtcgccggacgaagtggcgcgtattgccgagttggcgccgcggctcgcc
gctgcccagcgtatgcgccgcatgcgcgccggaggcgtggacgcgctgatgcgcgagttc
tcgctgtcgagcgacgaggggctggcgctgatgtgtctggccgaagcgctgctgcgcgtg
cccgatgccgcgaccgtcgaccggctgatccgcgaccgcctcgctgcgggcgactggcgt
gcccacgtgggccacgatccctcgctgttcgtcaacgccgccgcgtgggggctgctggcc
gggcgcaggctgctcgcgccggccgatgagcacggtctggcgcgcgcgctgcacgaggcg
ctcgcgcgcggcggcgagcccctgctgcggggcgcgatgcgcggtgccatgcgtctgctc
ggcgagcgcttcgtcgtcggccgcgacatcggcgaggcactgcgccgcgccgcgcgggca
cgcccctgtctgtactccttcgacatgctcggcgaggcggccatgaccgatgccgatgcg
cgcgtctatctcgccgcctacctggctgccgcgcgggcgatcggcgaggcggctggcgcg
cgtcattgcgacgagagcgacggcatgtcggtcaagctctcggcgctgtcgccgcgctac
gtctggtcgcagcccgagcgcctgcgcgaggaactgctgccgcgcctcgcctcggtatgc
catgtcgcggccgaggccggcatcggcctggccatcgacgccgaggaggccgaccggctc
gaaccctcgctcgatctcttcgaggccctgctggatgacccgcgactggctggctgggac
ggcctgggcttcgtcgtacaggcctaccagaagcgcgcgccggcgcttgtcgatcgtctg
gtcgaactggcccgcatgcgcgggcggcgcatcacggtgcgcctggtcaagggggcgtac
tgggacaccgagatcaagcgcgcccagctcgacggcgtggacgattacccggtgttcacg
cgcaaggcacataccgacctgtcgtggctggtgtgcgcgcgccgactgctggccgcgcgt
gcctggctgcgtccgcagttcgccacgcacaacgcgcactcggtcgcagccgtgctggcc
atggcgggggacgcgcgcgacttcgagttccagtgcctgcacggcatgggcgaggcgctc
tacgacggcctgctcgccgaacccgatgtggcgcgaacggtgcgcgtttacgggccggtg
ggcagtcacgagacgctgttgccctatctggtgcggcgtctgctcgagaacggcgccaac
agcagcttcgtgcatggcatcgtcgatcccggcgtgccgctggacaccctgctcgccgac
cccgccgagtgcgcgcgcgccgccggtggtcggccgcacccgcgcatcgcaactccaccc
gacttgtatgggccgacacggcgcaatccgtcaggcatcgatctggccagtcccggcgtg
cgtgcctccctcgcggcacgggtcgcagcggagctgggtcgtcgccatgtcgcctcgccg
ctgcttgccgtcgagcatgcgggcggaccgcgccgcacggtgcgtaatccggccgccctt
ggcgacgtcgtgggcgaggtcgaggaatgcgtgccggacgccgtgccgaccgccgtagag
gccgcgctgcgcgaaggcagggagtggggggcggtgccggcgacacggcgcgcggccgtg
ctcgaggccgccggtgacgtgctcgaggccgacgccgggcggctgctgccattgctcgtg
cgcgaagccggcaagacctggcacgcggccatcgccgaactgcgcgaggccgtcgatttc
tgccgctactacgccaatgccgcacgcgcgctggacatggacgcgcgtccgctgggtgcg
gtggtgtgcatcagcccgtggaatttcccgctggcgatcttcaccgggcagatcgccggc
gccctggcggccggcaacgccgtgctcgccaagccggccgagcagacgccgctcatcgcc
ttcgcggcgacgcgtgcgatgcatgcggccggcgtgccgcgtgccgcgctgcaactgctg
cccgagaaaggcgcgacggtgggtgcggcgctggtggccgatgcacgcatcggcggcgtg
ctgtttaccggttcgacggccaccgccggttcgatccgccgggtgctcgccgcgcgcgac
gatgaaccgttgctgatctgtgagaccggtggacagaacgcgctggtggcggactcgacc
gcgttgcccgagcagctcgtggccgacgtgatcgcctcggccttcgattcggccggccag
cgctgctcggcgctgcgcctgctgtgcgtgcaggaagacatcgccgaccgcgtcctggag
atgctgcgcggcgcagtggccgagcgcgtgctgggcgatccgcgcgacgcgcgcaccgac
atcggaccggtcatcgacgccgctgcgcgcgaccgcatcgaagactggatcgcgagtgtg
cgccgccgcggtctcgacgtctggcgtgcgccgctgcaggtacccgacggcggccatttc
gtcgtaccgacgatcatcgcgatcgacgatccggcgctgctcgccgaggagcacttcggg
ccggtgctgcatgtgctgcgtgtgcccgccgacggcatcgaagcggccatcgagcaagtc
aacgcgctcggcttcgggctgaccttcggcgtgcacagtcgcatcgggacgagcgttgcg
cgcttcgccttgctcgcgcgcgccggcaacgtctacgtcaatcgcaacatcgtcggcgcc
gtcgtgggggtgcagccgttcggcgggcacgggcgttccggcaccgggcccaaggccggc
gggccgctgtacgtgccgcgcctggcccgcggcgcggggctgccggcgctcgatttcgcg
cgtgcgccgcagctttcgcaggcatttaccgacttgctcgactggatcgcatgcggctcc
ggtgccttggcgtccgacgcgcgcggcgagttgctcgtggccggccgcgtctatgccgcc
gagaccctgtcagcgggcgagttgtccctgcccggaccgaccggcgaggataaccgcctg
tacttcgtgccggtgggtgtggtgacgtgcgtggccgcgcacgcgggcgcactgctgcac
cagatgctggcggccttcgccggcggcaacgaggtgcgcgtcgcgcgcgatgcgatgtcc
gcccgcgtgctcgcatcgcttccggcgacggtggtccgtggtgccgcgcacggcgacgat
gtgcgcgattgtgcggcggtattgttcgacggaccggacgcgcttgcgcgccagtggcgc
gagcggctggcgacgctcgatccggcgcccgaactgctgcgcccgcggccgcgctatgcg
ctcaaccgtctggtgcgcgagcgctgcgtcagcatcaacaccgccgcggccggtggcaac
gcggccctgttcgcactcggcggcggcgcatga

DBGET integrated database retrieval system