KEGG   Azoarcus sp. SY39: C0099_07535Help
Entry
C0099_07535       CDS       T05265                                 

Definition
(GenBank) phosphatase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
atw  Azoarcus sp. SY39
Brite
KEGG Orthology (KO) [BR:atw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C0099_07535
Enzymes [BR:atw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     C0099_07535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AUN94797
UniProt: A0A2I6S6A8
Position
1566157..1567008
Genome map
AA seq 283 aa AA seqDB search
MNDEPRNADLHCHSNASDGWMSPAEVVRRAHANGVDLLALTDHDTLAGLDEALAEAARLG
LDMVCGVEVSVTFANETVHIVGLGVDRADATLRAGLAGLRAGRIERARRMGAALAEAGVP
GVFERAMRLASNPEMIGRAHLARAIVDAGHQPDVGTVFRHYLAKGKPGYVEHRWATLEDA
VAWIRAAGGIAIVAHPARYRLDAIGMEHLFDRFAACGGEGVEVVSGAHDDDEIAEYAQLA
RRRGLLASRASDFHGPGESRVDLGGCLPLPAGLKPVWARLQGG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgaaccgcgcaacgccgatctgcactgccattccaacgcctcggacggctgg
atgtcgcccgccgaggtggtgcggcgcgcgcacgccaatggcgtggacctgctcgcgctg
accgaccatgacacgctcgccgggctcgacgaggcgctcgccgaagccgcgcgactgggg
ctggacatggtctgcggcgtggaggtttcggtgaccttcgccaacgagacggtgcacatc
gtcggcctgggggtcgatcgcgccgacgcgaccctgcgcgcggggctcgccggcctgcgc
gccgggcgcatcgaacgggcgcggcgcatgggcgcggcgctggccgaagcgggggtgccg
ggcgtgttcgaacgcgcgatgcgtctggcgagcaatcccgagatgatcggccgcgcgcac
cttgcgcgcgccatcgtcgacgccgggcatcagcccgacgtgggcacggtgttccggcat
tatcttgccaagggcaagcccggctacgtcgagcatcgctgggcgacgctcgaggatgcg
gtggcctggatccgcgcggccggcggaatcgcgatcgttgctcacccggcgcgctatcgg
ctcgatgcgatcggcatggagcatctgttcgaccgcttcgccgcctgcggtggcgagggt
gtcgaggtggtctccggtgcgcacgatgacgacgagatcgccgagtatgcacaactggcg
cgccgacgcggcctgcttgcctcgcgcgcctccgattttcatggccccggcgagagccgc
gtcgatctcggcggctgcctgccgttgccggctgggctcaagccggtgtgggcccgcttg
cagggaggttag

DBGET integrated database retrieval system