KEGG   Aureimonas sp. AU20: M673_00720Help
Entry
M673_00720        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00730  Thiamine metabolism
aua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    M673_00720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aua03000]
    M673_00720
Enzymes [BR:aua01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     M673_00720
Transcription factors [BR:aua03000]
 Prokaryotic type
  Other transcription factors
   Others
    M673_00720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: ALN71213
UniProt: A0A0S2EIT7
Position
162675..163349
Genome map
AA seq 224 aa AA seqDB search
MTGTVFERLKAAAQEDWDGYVNHPFVWHMGVGALPESAFRRYLVQDYLFLIQFARANALA
AYKSRSLADMRRAQTGLSAILDVELNLHLRLSERWGLSARDLEQAREEPATTAYTRFVLD
CGASGDLLDLQTALAPCVIGYGEIGARLAASLGPEHLENHPYREWIGEYAGEAYQGVAEA
ARLHLEDLAARSMTERRFEELVGLFATACRLERDFWQMGLGSDA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaccgtcttcgaacgattgaaggcggcggcgcaggaagactgggacggctat
gtcaaccatcccttcgtctggcacatgggcgtcggcgcgctgccggagagcgcctttcgc
cgctatctcgtgcaggactacctgttcctgatccagttcgctcgggccaacgcgctggcc
gcctacaagagccgatcgctggccgacatgcgccgggcgcagacgggcctctcggccatt
ctggatgtcgagctgaaccttcatctgcgcctgtcggagcgctggggcctgtcggcgcgg
gatctggaacaggcgcgcgaggaacccgccaccacggcctacacgcgcttcgtgctcgac
tgcggcgcttcgggcgacctgctcgaccttcagaccgcgctcgccccttgcgtcatcggc
tatggcgagatcggtgcgcggctggcagcttcgctcgggccggagcatttggagaatcat
ccctatcgcgaatggatcggggaatatgcgggcgaggcctatcagggcgtcgccgaggcg
gcgcgcctccatctcgaagacctcgccgcccgctcgatgacggagcgccgcttcgaggag
ctggtgggtctgttcgcgacggcctgtcggctggagcgcgatttctggcagatgggcctc
gggtccgacgcctga

DBGET integrated database retrieval system