KEGG   Aureimonas sp. AU20: M673_01120Help
Entry
M673_01120        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
aua  Aureimonas sp. AU20
Pathway
aua03060  Protein export
Brite
KEGG Orthology (KO) [BR:aua00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    M673_01120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aua01002]
    M673_01120
Enzymes [BR:aua01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     M673_01120
Peptidases [BR:aua01002]
 Aspartic Peptidases
  Family A8: signal peptidase II family
   M673_01120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A8
Motif
Other DBs
NCBI-ProteinID: ALN71292
UniProt: A0A0S2EJ00
Position
complement(249958..250458)
Genome map
AA seq 166 aa AA seqDB search
MNRLVPNLALVAFFAAIDQMVKLAVVRTMALGESIELLPFLALYHARNEGIAFSMLDGFH
DVGLAAISVLVLLFVVWLWWNTAPERKLTHIGFALIAGGAIGNLIDRVNLGYVVDYILFH
TPVWSFAVFNLADSFITIGAALILIDEFLVARRPKTSDGTAANDKT
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgcctcgttcccaatctggcgctcgtcgccttcttcgccgcgatcgaccagatg
gtgaagctcgccgtggtgcgcacgatggcgctgggcgagtcgattgagcttctcccgttc
ctcgcgctctaccacgcccgcaacgagggcatcgccttttccatgttggacgggttccac
gatgtcggccttgccgccatctcggtcctggtgctcctcttcgtggtctggctctggtgg
aacacggcgcccgagcgcaagctcacccatatcggcttcgcgctgatcgcgggcggggcg
atcggaaatctgatcgaccgggtgaatctcggctatgtcgtggactatatcctgttccac
acgccggtctggagcttcgccgtgttcaatctggcggacagtttcatcacgatcggcgcg
gcgctgatcctgatcgacgaattcctcgtggcgcgccggcccaagacatcggacgggacg
gcggcgaacgacaagacctga

DBGET integrated database retrieval system