KEGG   Aureimonas sp. AU20: M673_03545Help
Entry
M673_03545        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00860  Porphyrin and chlorophyll metabolism
aua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M673_03545
Enzymes [BR:aua01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     M673_03545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: ALN71772
UniProt: A0A0S2EKE0
Position
complement(767233..768702)
Genome map
AA seq 489 aa AA seqDB search
MLQGTGSDVGKSVLVAGLCRLFRNRGLTVRPFKPQNMSNNAAVARIPESGEWGEIGRAQW
LQALACGAEPSVHMNPVLLKPQSETGSQIVVQGRVAGAARGADYQRLKPALLGRVLESFA
RLEAEADLVLVEGAGSPAEINLRAGDIANMGFARAAGVPVVLVGDIDRGGVIASLVGTHT
ILPPEDLAPIRGFLVNKFRGDPTLFEDGLAAITRFTGWPSFGVVPWLTEASRLPAEDSVA
LEARRPPSEGAARLLVAVPVLDRIANFDDLDPLAAEPGVEVRFVRPGEPLPLDAGLVVLP
GTKSTIADLLAFRRNGWDADLKRHHARGGRILGLCGGYQMLGRRIRDPDGVDGAIPEAEG
LGLLDVETVMQGPKTVRAASGTSPEGLALEGYEIHMGATAGPDRERPFATLLGRPEGARS
ADGQVEGTYLHGVFGSDPWRRHLLQSLGLSGPENAYRAGIEAALDAIAARLEQHLDADAL
LRLAQRAGD
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgctccagggcacgggctcggatgtcggcaagagcgtgctcgtcgccgggctttgcagg
ctgttccgcaatcggggtctgacggttcgccccttcaagccgcagaacatgagcaacaat
gccgccgtcgcccgcattcccgagagcggcgaatggggcgagatcggccgggcgcagtgg
ctgcaggccctggcttgcggcgccgagcccagcgtccacatgaacccggttcttctgaag
ccccagtccgagaccggctcgcagatcgtggtgcaggggcgcgtcgcgggcgccgcgcgt
ggcgccgattatcagcgcctcaagccggcgctgctcggccgcgtgctcgagagtttcgcg
cgcctggaggcggaggcggacctcgttctggtggagggcgcgggctcgccggccgagatc
aacctgcgggccggcgacatcgccaatatgggctttgcccgggctgccggcgtgcccgtg
gtgctggtcggggacatcgaccggggcggcgtcatcgcctctctagtgggcacccacacg
atcctgccgcccgaggatctggcgccgatcagaggctttctcgtcaacaagttccggggc
gacccgaccctgttcgaggacgggctcgccgccatcacacgcttcaccggctggccgagc
ttcggcgtcgtgccctggctgacggaggcgagccgcctgccggcggaggattcggtggcg
ctggaagcgcggcggccgcccagcgaaggcgcggcccgccttctcgtcgccgtgcccgtg
ctcgaccgcatcgccaatttcgacgatctcgacccgctcgccgccgagcctggagtcgag
gtgcgcttcgtgcgccccggcgagccgctgccgcttgacgcggggctcgtcgtcctgccc
ggcacgaaatccacgatcgccgatctcctggcgtttcgccgcaacggctgggacgccgat
ctcaagcgccaccacgcgcgcggcgggcgcattctcggcctgtgtggcggctaccagatg
ttgggtcggcgcatccgcgaccccgacggcgtggacggcgcgattcccgaggccgagggg
ctcggccttctcgacgtcgaaaccgtgatgcaggggccgaagaccgtgcgcgccgccagc
ggcacctcgcccgaagggttggcgctggagggctacgagatccatatgggcgcgacggcg
gggccggaccgcgagcgccccttcgccacgcttctcggccggccggagggcgcgcgcagc
gccgacgggcaggtcgaggggacctatctccacggcgtcttcggctccgacccctggcgc
cgccacctgctccagagccttggcctgtccggccccgagaacgcctaccgcgccggcatc
gaggccgcgctcgacgccatcgccgcccggctggagcagcatctcgacgccgacgcgctc
ctgcgtctggcgcagcgcgcgggcgactga

DBGET integrated database retrieval system