KEGG   Aureimonas sp. AU20: M673_05170Help
Entry
M673_05170        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00620  Pyruvate metabolism
aua00630  Glyoxylate and dicarboxylate metabolism
aua01100  Metabolic pathways
aua01110  Biosynthesis of secondary metabolites
aua01120  Microbial metabolism in diverse environments
aua01200  Carbon metabolism
Module
aua_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M673_05170
   00630 Glyoxylate and dicarboxylate metabolism
    M673_05170
Enzymes [BR:aua01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     M673_05170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ALN72095
UniProt: A0A0S2ELI7
Position
1104607..1106787
Genome map
AA seq 726 aa AA seqDB search
MSDYVELHGLKVSPILKDFAETEALPGTGIEPDRFWHALADLLTDLAPRNRELLQRRDEL
QAQIDAWCREHKGAAVDGAEAESFLREIGYLVPEGPAFSVETANVDPEIATIAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDAISDEGGAERGKGYNAQRGAKVVAWARDFLDRAV
ALNGASWRDAKSFEIENGRLCARLGDARLVPLADPAAFAGYKGEVSSPTGLLLRNNGLHL
EIVIDRTSAIGRTDHAGISDVLLESAVTTIQDCEDSVAAVDAEDKAAVYRNWLGLMRGDL
VETFQKGGETVTRRLEADRTYTAPDGSTLTLPGRSLMLVRNVGHLMTNPAVLLADGSEAP
EGLLDALFTVTIALHDLQKTEGPRNSRAGSVYIVKPKMHGPDEVEFADEIFARVEAALGL
EPNTVKMGIMDEERRTTANLKECIRRARRRVVFINTGFLDRTGDEMHTSMELGPMIRKGD
MKASTWIKAYEDRNVDTGLACGLKGHAQIGKGMWAMPDKMAAMLEQKIGHPKAGANTAWV
PSPTAATLHATHYHEVDVAEVQAKLEGHPRTQLTDILTIPVAVRPNWTPEDVQAELDNNA
QGILGYVVRWVDAGVGCSKVPDINNVGLMEDRATCRISSQHIANWLLHGVVTQAQVVETM
KRMAAVVDGQNAGDPLYQPMAPEFDRSIAFQAALDLVLKGREQPNGYTEPVLHRRRLEKK
ADARRA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattacgtcgagcttcatggcctgaaggtctcgcccatcctcaaggatttcgcc
gagaccgaggcgctgccgggaaccggcatcgagcccgaccgcttctggcacgcgctcgcc
gatctcctgaccgacctcgccccgcgcaaccgcgagcttctccagcgccgcgacgagctg
caggctcagatcgacgcctggtgccgcgagcacaagggcgcggcggtggacggcgcggag
gccgagagcttcctgcgcgagatcggctatctcgtgcccgaaggcccggccttttcggtc
gagaccgccaatgtcgatcccgagatcgccaccatcgccggaccgcagctcgtcgtgccg
gtgctgaacgcccgcttcgcgctgaacgcggcgaacgcgcgttggggttcgctctacgac
gcgctctacggcaccgacgccatttccgacgagggcggcgccgagcgcggcaagggctac
aacgcgcagcgcggcgccaaggtcgtcgcttgggcgcgcgacttcctcgaccgcgccgtg
gcgctgaacggcgcctcctggcgcgacgccaaaagcttcgagatcgagaacggccggctc
tgcgcgcgcctgggcgacgcgcgcctcgtgccgctggccgaccccgctgccttcgccggc
tacaagggcgaggtgtcgagcccgaccgggctgctcctgcgcaacaacggcctgcacctc
gaaatcgtcatcgaccgcacgtccgcgatcggacgcaccgaccatgccggcatttccgac
gtgctgctcgaaagcgcggtgacgacgatccaggattgcgaggattccgtcgcggcggtg
gacgccgaggacaaggcggctgtctatcgtaactggctgggtctgatgcggggcgacctc
gtcgaaaccttccagaagggcggcgagaccgtgacccgccgcctggaggcggaccgaacc
tacaccgcgccggacggctcgacgctcaccctgccgggccgctcgctcatgctggtgcgc
aatgtcggccacctcatgaccaaccccgccgtgctcctggccgatggctcggaggcgccc
gaaggtctgctcgacgcgctgttcaccgtcacgatcgcgctgcacgacctgcagaagacc
gaaggcccgcgcaacagccgagccggctcggtctatatcgtgaagcccaagatgcacggg
ccggacgaggtggagttcgccgacgaaatcttcgcccgcgtcgaggccgcgctgggcctc
gagcccaacacggtgaagatgggcatcatggatgaggagcgccgcaccacggccaacctc
aaggagtgcatccgccgggcgcgccgccgcgtcgtcttcatcaacaccggcttcctcgac
cggaccggcgacgagatgcacacgtcgatggaactcggccccatgatccgcaagggcgac
atgaaggcctcaacctggatcaaggcctacgaggaccgcaatgtcgacaccggccttgcc
tgcggcctgaaggggcatgcgcagatcggcaagggcatgtgggccatgcccgacaagatg
gccgcgatgctggagcagaagatcggccatcccaaggccggcgccaacacggcttgggtg
ccatcgcctaccgccgcgacgctgcacgccacgcattatcacgaggtggatgtcgccgag
gtgcaggccaagctcgagggccacccgcgcacccagctcaccgacatcctcaccattccc
gtcgccgtgcgcccgaactggacgcccgaggatgtgcaggccgagctcgacaacaacgcg
cagggcattctcggctatgtcgtgcgctgggtggatgccggcgtcggctgttccaaggtg
ccagacatcaacaatgtcggcctgatggaagaccgcgccacctgccgcatctcctcgcag
cacatcgccaactggctgctgcacggcgtcgtcacgcaggcgcaggtggtggagacgatg
aagcgcatggccgccgtggtggatgggcagaacgcgggcgatccgctctatcagccgatg
gcgcccgagttcgaccgctccatcgccttccaggcggcgctcgatctcgtgctcaagggc
cgtgagcagccgaacggctataccgagccggtcctgcaccgccgccgcctggagaagaag
gccgacgcgcgccgcgcctga

DBGET integrated database retrieval system