KEGG   Aureimonas sp. AU20: M673_05585Help
Entry
M673_05585        CDS       T04161                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00071  Fatty acid degradation
aua00072  Synthesis and degradation of ketone bodies
aua00280  Valine, leucine and isoleucine degradation
aua00310  Lysine degradation
aua00362  Benzoate degradation
aua00380  Tryptophan metabolism
aua00620  Pyruvate metabolism
aua00630  Glyoxylate and dicarboxylate metabolism
aua00640  Propanoate metabolism
aua00650  Butanoate metabolism
aua00900  Terpenoid backbone biosynthesis
aua01100  Metabolic pathways
aua01110  Biosynthesis of secondary metabolites
aua01120  Microbial metabolism in diverse environments
aua01130  Biosynthesis of antibiotics
aua01200  Carbon metabolism
aua01212  Fatty acid metabolism
aua02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M673_05585
   00630 Glyoxylate and dicarboxylate metabolism
    M673_05585
   00640 Propanoate metabolism
    M673_05585
   00650 Butanoate metabolism
    M673_05585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M673_05585
   00072 Synthesis and degradation of ketone bodies
    M673_05585
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M673_05585
   00310 Lysine degradation
    M673_05585
   00380 Tryptophan metabolism
    M673_05585
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M673_05585
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M673_05585
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M673_05585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aua04147]
    M673_05585
Enzymes [BR:aua01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M673_05585
Exosome [BR:aua04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M673_05585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALN72178
UniProt: A0A0S2ELM2
Position
1200326..1201510
Genome map
AA seq 394 aa AA seqDB search
MSALQRIVIVGAARTPVGSFNGAFANVPAHLLGVAAITEALKRAGVEPGEVDEVILGQVL
QAAEGQNPARQAAMKAGVPKEASAWGLNQLCGSGLRAVALGAQQIATGDARVVVAGGQES
MSMAPHAAHLRAGQKMGDLKFIDTMLKDGLIDAFQGYHMGNTAENVARQWQITRDEQDEF
AVRSQNKAEAAQKAGRFKDEIVPFTVSSRKGDVVVEEDEYIKPGTTLDKVQKLKPAFDKE
GTVTAGNASGINDGAAALVLMTEEEATRRGLTPLARIASFATVGVDPAVMGSGPIPASRR
ALEKAGWRIEDLELVEANEAFAAQACAVNKDLGWNPDIVNVNGGAIAIGHPIGASGARCL
NTLLYEMRRREVKRGLATLCVGGGMGVAMCLERF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattgcagcggatcgtcatcgtcggagcggcccgtacgccggtcggctccttc
aacggagccttcgccaacgtcccggcccatcttctcggcgtcgccgccatcaccgaggcg
ctgaagcgcgccggcgtcgagcccggcgaggtggacgaggtgatcctcggccaggtcctc
caggcggccgaagggcagaatcccgcgcgccaggcggccatgaaggcgggcgtgccgaag
gaggcttcggcctgggggctcaaccagctctgcggctcgggccttcgcgccgtggcgctc
ggcgcgcagcagatcgccacgggcgatgcgcgcgtcgtggttgcaggcgggcaggagtcc
atgtccatggcgccccatgccgcgcacttgcgcgccggccagaagatgggcgacctgaag
ttcatcgacacgatgctgaaggacggcctgatcgacgccttccagggctaccacatgggc
aacacggccgagaacgtcgcccgccagtggcagatcacgcgcgacgagcaggacgaattc
gccgtccgctcgcagaacaaggcggaagccgcgcagaaggccggccgcttcaaggacgag
atcgttccctttaccgtgtccagccgcaagggcgacgtggtggtcgaggaagacgagtac
atcaaacccggcacgacgctggacaaagtgcagaagctgaagcccgccttcgacaaagaa
ggcacggtcaccgccggcaacgcgtcgggcatcaacgacggtgcggccgccttggtgctg
atgaccgaggaggaggccacgcggcgcggcttgacgccgctcgcccgcatcgcctccttc
gccactgtcggcgtcgatccggccgtgatgggctccggcccgatccccgcgtcccgccgc
gcgctggaaaaggcgggctggcggatcgaggatctcgagctcgtcgaggccaacgaggcc
ttcgccgcgcaggcctgcgcggtgaacaaggatctcggctggaatcccgacatcgtcaac
gtcaacggcggcgccatcgcgatcggccatccgatcggcgcgtccggcgcccgctgcctc
aacacgcttctctacgagatgcgccggcgcgaggtgaagcgcggcctcgccacgctctgc
gtcggcggcggcatgggtgtcgccatgtgcctcgagcgcttctga

DBGET integrated database retrieval system