KEGG   Aureimonas sp. AU20: M673_15910Help
Entry
M673_15910        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
aua  Aureimonas sp. AU20
Brite
KEGG Orthology (KO) [BR:aua00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    M673_15910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ALN74211
UniProt: A0A0S2ESG5
Position
3407517..3407909
Genome map
AA seq 130 aa AA seqDB search
MYKATTRHITVCVSPSFLPDQSDPEDGRWVFAYRIEIENGSRETVQLRSRYWHITNGRGQ
VEEVRGPGVVGEEPILSPGDSFTYTSGCPLGTPSGIMRGSFRMETADGRAFDIEVPAFSL
DAPEGVRVLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggcgacgacgcggcacatcacggtttgcgtgagcccgagctttcttcccgac
cagtccgaccccgaagacggacgctgggtcttcgcctatcgcatcgagatcgagaacggt
tcgcgcgagacggtgcagctgcgctcgcgctattggcacatcaccaacgggcgcgggcag
gtggaggaagtgcgcgggccgggcgtggtgggcgaggagccgatcctctcgccgggcgac
agcttcacctatacgtcgggctgcccgctgggcacgccgtccggcatcatgcgcggctcg
ttccgcatggaaacggcggacggacgggccttcgacatcgaagtgcccgccttttcgctg
gatgccccggagggcgtgcgcgtcctcaactga

DBGET integrated database retrieval system