KEGG   Aureimonas sp. AU20: M673_16975Help
Entry
M673_16975        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00040  Pentose and glucuronate interconversions
aua00053  Ascorbate and aldarate metabolism
aua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M673_16975
   00053 Ascorbate and aldarate metabolism
    M673_16975
Enzymes [BR:aua01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     M673_16975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: ALN74424
UniProt: A0A0S2ESX3
Position
complement(3628233..3629816)
Genome map
AA seq 527 aa AA seqDB search
MTIQGEMIVGHTLAKGAKGEIFGIEAATGQRLDPAFGGATKDDLETACRLADEAFDTYRE
TGLEERARFLEAIAEEIQNLGDALIERCCQESGLPRGRIEGERGRTMGQLRMFAGVLRDG
GFLDARVDPAMPDRQPLPRPDLRLRNVALGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VVAKAHSAHPGTSELIGRAVLAAAKRCGMPEGVFSLLFDSGREIGQGLVADRRIKAVGFT
GSRGGGTALMKIAASRPEPIPVYAEMSSINPVILFPGALKERAEAIAKGFVGSLTLGAGQ
FCTNPGLVLAVEGEGLDAFAAAAAEALAGTAASVMLTPGIHEAYASGVSKLAGHARVETL
ARGQEGGALRGQSALFAVSASEFLSDPHLQEEVFGASSLVVRCRDEAELTEVVRKLEGQL
TAAIHITESDHEAARRLLPLLEKRAGRILVNGFGTGVEVGHAMVHGGPYPSTSDGRSTSV
GSKAIERFLRPVSYQDLPDALLPDALKDANPLKLWRRRDGKLVAPDA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcagggcgagatgatcgtcggccacacgctggccaagggcgcgaagggtgag
attttcgggatcgaagcggccaccggccagcgcctcgatccggccttcgggggcgccacg
aaggacgacctcgaaacggcctgccgcctggccgacgaagccttcgacacctatcgcgaa
accgggctggaagagcgcgcgcgctttctggaggcgatcgccgaggagatccaaaatctc
ggcgacgccctgatcgagcgctgctgccaggaaagcggcctgccgcgcggccgcatcgaa
ggcgagcgcggccgcaccatgggccagcttcgcatgttcgccggcgtgttgcgcgacggc
ggcttcctcgacgcgcgggtcgatcccgccatgcccgaccgccagcccctgccgcgcccg
gaccttcggctgcgcaacgtcgcgctcggcccggttgcggtgttcggcgcctccaacttc
ccgctcgccttctccgtcgccggcggcgacacggcctcggcgctggccgccggctgcccg
gtcgtggccaaggcgcactcggcccatcccggcacgtcggagctgatcggccgcgccgtt
ctggcggcggccaagcgctgcggcatgcccgagggcgtgttctcgcttctgttcgattcc
ggccgcgagatcggccagggcctggtcgccgaccggcgcatcaaggccgtcggcttcacc
ggctcgcgcggcggcggcacggcgctgatgaagatcgcagcctcgcggcccgagccgatc
ccggtctatgccgagatgagctcgatcaacccggtgatcctcttccccggcgcgctcaag
gagcgtgcggaggccatcgccaagggcttcgtcggctcgctgacgctcggcgccggccag
ttctgcaccaatcccggcctcgtgctggcggtcgagggcgaagggctggacgcattcgcc
gccgctgccgccgaagcgctggccggcaccgccgcctccgtcatgctgacgccgggcatc
catgaggcctatgcctccggcgtgtcgaagctcgccggccatgcccgcgtcgagacgctg
gcccgcggccaggaaggcggcgcgctgcgcggccagtccgcgctcttcgccgtgtcggcc
tccgagttcctgtccgatccgcatctccaggaagaggtgttcggcgcctcctcgctggtt
gtgcgctgccgcgacgaggccgagctgaccgaggtcgtgcgtaagctcgaaggccagctc
acagccgcgatccacatcaccgaaagcgaccacgaggccgcccgccggctcctgccgctc
ttggagaagcgggccgggcgcatcctggtcaacggcttcggcacgggcgtcgaggtcggc
catgccatggtgcatggcggcccgtacccctccacctcggacgggcgctccacctcggtc
ggctccaaggcgatcgagcgcttcctgcgcccggtcagctatcaggacctgccggacgcg
ctcctgccggacgcgctgaaggacgccaacccgctgaagctctggcgccgccgcgacggc
aagctggtcgccccggacgcctga

DBGET integrated database retrieval system