KEGG   Aureimonas sp. AU20: M673_18115Help
Entry
M673_18115        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M673_18115
Enzymes [BR:aua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     M673_18115
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     M673_18115
    1.1.1.-  
     M673_18115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ALN74637
UniProt: A0A0S2ETK0
Position
pAU20a:142132..143211
Genome map
AA seq 359 aa AA seqDB search
MTMQALRFHAAKDLRLETVEEPGRPGPGQVRIRNTRVGICGTDLHEYAYGPIFVPTEPHA
FTGVSGVQILGHEFGGVVTDVGGGVTKVAPGDRVSVQPLIMPRENEYYADRGLFFLSEKL
ALAGLSWPWGGMADYAILNDYNVYKIPDAMSAEEAALVEPTAVAIYACDRAGVRAGSSVL
VTGAGPIGLLTVLAARAAGATRVFLSDPNPTRLELARSIDPDLVTIDPTKTPVGERVREG
TDGRVGADVAIEAVGNERALGDCVDAVRRQGVVVQVGLHPGPSKLDWFAVTCKDIDVRGS
WAYPTTSWPRVMDLIASGRLPAAKVVTKRIRLADAVHEGFDALLDPAGNHLKIMIDLEG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgcaagcactgcgtttccacgccgccaaggacctgcgtctggaaacggtcgaa
gaacccggccgtccggggccgggacaggtccgcatccgcaacacgcgcgtcggcatctgc
ggcacggaccttcacgaatatgcctatggcccgatcttcgtgccgaccgagccgcacgcc
ttcaccggcgtctcgggcgtgcaaattctcggccacgagttcggcggcgtcgtcaccgat
gtcggcgggggggtgaccaaggtcgcgccgggcgaccgggtgtccgtgcagccgctgatc
atgccgcgcgagaacgaatattacgccgatcgcggcctgttcttcctgtcggagaagctg
gcgctggctggcctctcctggccttggggcggcatggccgactatgccatcctcaacgat
tacaatgtctacaagataccggacgcgatgagcgccgaggaagccgcgctggtggagccg
acggcggtcgccatctatgcctgcgaccgggcgggcgtgcgggccggctccagcgtcctc
gtgacgggcgcggggccgatcggtctcctcaccgtcctggcggcgcgggcggcgggcgcg
acgcgcgttttcctgtcggaccccaacccgacgcggctcgaactcgctcgctccatcgac
cccgatctcgtcacgatcgacccgacgaagacaccggtgggcgagcgcgtgcgcgaggga
acggacggacgggtcggcgccgacgtggcgatcgaggccgttggcaacgagcgcgccttg
ggcgactgcgtggatgccgtgcgtcggcaaggcgtcgtggtgcaggtcggccttcatccc
ggcccgtccaagctcgactggttcgccgtgacctgcaaggacatcgacgttcgcggctcc
tgggcctaccccaccacgtcctggccgcgcgtcatggatctcatcgcctccggccgtctg
ccggccgcgaaagtcgtgaccaagcgcattcgcctcgccgacgccgtgcacgagggcttc
gacgcactgctcgatcccgccggcaaccatctcaagatcatgatcgacctcgaaggctga

DBGET integrated database retrieval system