KEGG   Aureitalea sp. RR4-38: C5O00_03060Help
Entry
C5O00_03060       CDS       T05335                                 

Definition
(GenBank) aromatic amino acid hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
aue  Aureitalea sp. RR4-38
Pathway
aue00360  Phenylalanine metabolism
aue00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aue00790  Folate biosynthesis
aue01100  Metabolic pathways
aue01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aue00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    C5O00_03060
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C5O00_03060
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C5O00_03060
Enzymes [BR:aue01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     C5O00_03060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AVI50201
UniProt: A0A2S0HU42
Position
668040..669803
Genome map
AA seq 587 aa AA seqDB search
MEERYESNELIERLPPHLKQFIKPQNYEDYTAVDQAVWRYVMRKNVDYLSQVAHESYLDG
LRKTGISIDSIPSMYGMNRILKEIGWAAVAVDGFIPPNAFMEFQAYKILVIASDIRQLEN
IEYTPAPDIIHEGAGHAPIIASPDYAEYLRRFGEIGAKAITSAHDNEMYEAVRELSILKE
AHNSSVEDLEDKIRAAEQKVDALQQKKVEPSEMALIRNLHWWTVEYGLVGTVDNPKIYGA
GLLSSIGESAWCMKPEVKKLPYTIDAAYQEFDITKPQPQLYVTPDFAYLQEVLEEFANTM
AVRKGGWRGLKKLIGSKQLGTIELSTGLQVSGVFTRMIQNEDNEVVYFETEGETALAYRE
KEVIGHGISRHKNGFRSPLGKLKGINLSIENMGPRDLQAYNFYDGKPISFEFESGITVDG
LNVTGMRNLSGKLMLIQFTDCTVRYREEILFSPEMGDFDMAVGKEIVSAFAGAADYRSYD
VLSHTLSGTETVRVSLSEAEKKRNQLYQKVREQRESNAIDLPALTSIFKILSQEFPEDWL
LSLEILDLTRGKDDSFSEKIIEHLTTVKKNRPEVAHLIDNGLSLINK
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacgctacgaaagtaacgagttgatagagcgcttaccacctcatctgaagcaa
tttatcaaaccgcaaaattatgaggattatacggctgtcgatcaggccgtgtggcgctat
gtaatgcgaaaaaatgtggattatctcagccaggtagcacatgagagctatctggacgga
ttaagaaagaccgggatctctatagacagcataccttccatgtacgggatgaaccgtatc
ctaaaggaaattggctgggcggccgtggctgttgatggttttatccctccgaatgctttt
atggaattccaggcttataagatcctggtaattgccagtgacatacgccagcttgaaaac
atcgaatatactcctgccccagacatcattcatgaaggtgccggacatgccccaattata
gcaagcccggattatgccgagtatctaaggcgtttcggagagataggcgccaaggcgatc
accagtgcacatgataacgaaatgtacgaagcagtacgagaactctctattctcaaagaa
gctcataattcttccgtggaagacctggaggacaagatcagggcagctgaacaaaaagtg
gatgcgcttcagcagaaaaaagtagaaccatccgaaatggcactcatccgtaatctacac
tggtggacggtagaatacggtcttgttggcactgttgataacccaaagatctacggagcc
ggactgttgtcgtccataggtgaaagcgcatggtgcatgaaaccggaagtgaagaaactg
ccgtacactatagatgcggcctaccaggaattcgacattacaaaaccgcaaccccaacta
tacgtcacaccggattttgcttacctgcaggaagtacttgaggagtttgcaaataccatg
gctgtgcgaaaaggtggctggcggggcttaaaaaaacttattggcagcaaacaactgggc
actatagaattaagtactggcttacaagtaagtggagtgtttacccgaatgatccaaaat
gaggataatgaagttgtctattttgaaacagagggtgaaacggctcttgcataccgggag
aaggaggtgatcggacatggtattagccgtcacaagaatggattccgttcacccttgggg
aagttgaaaggaattaacttatcgatcgagaatatgggccccagagatcttcaggcgtat
aatttctacgatggaaaacccatttccttcgaatttgaaagtggaattaccgtagatggc
ctcaatgttacaggtatgcgaaacctcagcggcaaattaatgcttatccaatttaccgat
tgtacggtacgttaccgggaagagatcctattttctcccgaaatgggcgatttcgatatg
gcggtaggaaaagagatcgtttcggctttcgcgggcgcggcagattatcgctcctacgat
gtactatctcatacactaagtggcaccgaaacggttcgtgtgtccctttcagaagcggaa
aaaaaacgcaaccagctttatcaaaaagttcgggaacagagagagagcaatgcgatagac
ttaccagcacttacttcaatctttaaaattttatcgcaggaattcccggaagactggctg
ttaagtctcgaaattctggatctcacacgaggcaaagacgattcgttttcagaaaaaata
atagaacacctaaccactgtaaaaaagaataggcctgaagtagctcatcttatagacaat
ggcctttctttaatcaataaataa

DBGET integrated database retrieval system