KEGG   Aureitalea sp. RR4-38: C5O00_03380Help
Entry
C5O00_03380       CDS       T05335                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
aue  Aureitalea sp. RR4-38
Pathway
aue00471  D-Glutamine and D-glutamate metabolism
aue01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aue00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C5O00_03380 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aue01011]
    C5O00_03380 (murI)
Enzymes [BR:aue01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     C5O00_03380 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:aue01011]
 Precursor biosynthesis
  Racemase
   C5O00_03380 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race CbtA_toxin
Motif
Other DBs
NCBI-ProteinID: AVI50259
UniProt: A0A2S0HUA8
Position
742495..743283
Genome map
AA seq 262 aa AA seqDB search
MKADNPIGIFDSGVGGTSIWKEIHQLLPNEHTLYLADSKNAPYGNRSAEEISALSVKNTE
KLLEMGAKIIVVACNTATTNAISLLRKNYDIPFIGIEPAIKPAALQSKTGKIGILATRGT
LSSALFSQTSDTFTKDISVVEVIGEGLVPLIENGDFDNPELDKLLQKYIKPMIAANVDYL
VLGCSHYPYLIPKLSKILPEHIKIIDSGIAVAKQTKFLLEKHDLIRKEISTPKLQFYSNT
GIGTLKYLLGEFDNIEIETMDF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagataatccaataggtattttcgattcgggcgtaggcggtacttctatatgg
aaggagattcaccagctactccctaatgaacataccttgtatctggccgatagtaaaaac
gctccgtacggaaatagatcggccgaagagatcagtgcccttagcgttaaaaatacagag
aaactgctggagatgggagccaagatcatcgtggtggcctgtaataccgccaccaccaac
gccatttccctactcaggaaaaattacgatatcccttttattggtatagagccggctata
aaacctgctgccctgcaaagcaaaacaggtaaaatagggatcctcgcaacccgtgggacc
cttagcagtgcgctcttctctcaaacaagcgacacatttacaaaggatatttcggtagta
gaagtaataggagaaggcctagtacctcttattgaaaatggtgacttcgacaatccggag
ctcgacaaattacttcagaaatacataaaacccatgatcgcggccaatgtggattacctc
gttctgggatgcagccattacccttacctgatcccaaaactttcaaaaatactccccgaa
catataaagattatcgattcggggatcgcggtagctaaacagactaaattcctgctggag
aaacacgatcttattcgaaaagaaatttcaactcctaagctccaattttattcaaatacc
ggtattggcaccttgaaatacctgctgggcgagtttgataatatagaaatcgagacaatg
gatttctaa

DBGET integrated database retrieval system