KEGG   Aureitalea sp. RR4-38: C5O00_08345Help
Entry
C5O00_08345       CDS       T05335                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
aue  Aureitalea sp. RR4-38
Pathway
aue00670  One carbon pool by folate
aue01100  Metabolic pathways
aue01120  Microbial metabolism in diverse environments
aue01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aue00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    C5O00_08345 (metF)
Enzymes [BR:aue01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     C5O00_08345 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AVI51184
UniProt: A0A2S0HXA2
Position
1856392..1857348
Genome map
AA seq 318 aa AA seqDB search
MKVTEHIANGKGKTQFSFEILPPLKGQNIQSIFDSIDPLMEFKPPFIDVTYHREEYVYKE
MENGLLQKKVVKKRPGTVGICAAIQNKYQVDAIPHILCGGFTKEDTENFLIDLDFLGIDN
VMALRGDAVKTETYFTPEKEGHRYANELVQQIDALNKGEYLDEEIMNQAQTDFCIGVAGY
PEKHMEAPNMESDLHFLKKKLKNGAEYIVTQMFFDNNKYFEFVEKCRSAGITAPIIPGLK
PISTKKQLNLIPQRFNADLPEALIKEVLKCETNEQVKEVGIEWCVEQSKELIKEKVPFLH
YYSMGKSDNIKAIARQLF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaacagaacatattgccaacggaaagggaaaaacccagttttcattcgaaatt
ttaccccctttgaaggggcagaatatccagtcgatcttcgacagtatcgaccccctaatg
gagttcaaaccaccctttatcgacgtaacgtaccatcgggaagagtacgtttataaagaa
atggaaaatgggctacttcagaaaaaagtagtgaaaaaacgacccgggactgtaggtatt
tgcgccgccatacagaataagtaccaggtagatgctataccgcatatactttgcggtggc
tttacaaaagaggacacagagaatttcctgatcgacctggatttcctggggattgataat
gtaatggccttgcgtggggatgccgtgaaaacagagacctatttcactcccgagaaggaa
ggccatcgttatgcaaatgagttggttcaacagatagatgctctcaataaaggcgaatac
ctggacgaggaaataatgaatcaggcacagacagatttctgtattggcgtggcgggatat
cccgagaaacatatggaagctcccaatatggaaagcgatttacattttctgaaaaagaaa
cttaagaacggtgcggaatatattgttacccagatgttctttgataacaataagtatttt
gaatttgtggaaaagtgtcgctctgcgggaataactgcgcctatcatccccggacttaaa
cctatttctactaagaaacaattaaaccttatcccgcagcgatttaatgcagacctgcct
gaagcccttatcaaggaagtccttaaatgtgagactaatgaacaggtaaaagaggtaggg
atcgagtggtgtgtggaacaaagcaaagaacttataaaggaaaaggttccctttctgcat
tattattctatgggaaagagtgataatataaaggcaattgcgaggcaattattttaa

DBGET integrated database retrieval system