KEGG   Aureitalea sp. RR4-38: C5O00_08535Help
Entry
C5O00_08535       CDS       T05335                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
aue  Aureitalea sp. RR4-38
Pathway
aue00471  D-Glutamine and D-glutamate metabolism
aue00550  Peptidoglycan biosynthesis
aue01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aue00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C5O00_08535 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C5O00_08535 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aue01011]
    C5O00_08535 (murD)
Enzymes [BR:aue01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     C5O00_08535 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:aue01011]
 Precursor biosynthesis
  Amino acid ligase
   C5O00_08535 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AVI51218
UniProt: A0A2S0HX62
Position
1891265..1892599
Genome map
AA seq 444 aa AA seqDB search
MQRLVVLGAGESGVGSAILGKKEGFEVFVSDFGKVKETYKEVLIHHEIEWEEENHSEEKI
LNANLVMKSPGIPDKAPIVTKLVKAGIKIVSEIEFAAWFTEAQLIGITGTNGKTTTATLT
YELLKQGGLNVGLGGNIGKSFAGMVADNAFENYVLELSSFQLDGIEKYRNHIAVILNIVP
DHLDRYDNDFSRYVAAKFRIIMNQSEQDYFIYDADDEVISRWLAANEIRSQKMPFSVTKK
LEKGAWIENEKLIIKLNNKEEIMPIATLGLQGQHNIKNAMAASTVATLLKIRKATIRESL
ENFQGVEHRLERVLKINNVLYINDSKATNVNATFYALDSMETPTVWIVGGVDKGNDYAEL
LPLVNEKVKAIICLGIDNDKIIEQFGSCVDIVVETDSMKSAVQVAYRLSEKGDTVLLSPA
CASFDLFKNYEDRGRQFKEAVRNL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggctggtagttttaggagcaggagagagtggtgttggaagcgcaattttgggt
aaaaaagaaggtttcgaggtatttgtttcagacttcggaaaagtaaaagaaacatataaa
gaagttcttatacatcatgagatcgagtgggaggaggagaatcattcggaagaaaagatc
ctgaatgctaacctcgtaatgaagagtcccggaataccggataaggcacctattgtaacg
aaactagtgaaagccgggataaagattgtttcagagatcgaatttgctgcttggtttacc
gaagcacagttaattgggatcacagggacaaacggaaaaacgaccaccgctactttaacc
tacgaattgcttaagcaaggaggattaaatgtgggccttggggggaatataggtaaaagc
tttgcagggatggttgccgataatgccttcgaaaactatgtgctggaactaagtagcttt
cagttggatggcatagagaaatatcgcaatcacattgctgtcatcctgaatatcgttccg
gatcacctggaccgctatgacaatgattttagtcgctatgtggcagctaaattcaggata
atcatgaatcagtctgagcaggattattttatctacgacgcagacgatgaggtgataagc
agatggcttgcagccaatgagatacgatctcagaaaatgcctttttcagtaacaaaaaag
ttagaaaaaggcgcatggatagaaaacgaaaaattaataataaaactaaacaacaaagaa
gaaattatgccaatcgcaacactaggattacaaggacaacacaatattaaaaatgccatg
gctgcctctacggtagctaccttattaaagattaggaaggcaaccattagagagtcttta
gagaattttcagggagtagaacaccgtctggagcgggtgttaaagattaacaacgtactg
tatatcaacgactctaaagctaccaatgtaaatgccactttctacgcattggacagcatg
gaaacaccaaccgtttggatcgtgggaggagtggataaaggaaacgattatgccgaatta
ctaccattggtcaacgaaaaagtaaaggcgatcatctgcctggggatagacaacgataag
atcatcgaacaatttggaagctgcgtggatatagtagtggaaacagattcgatgaaaagt
gctgtgcaagtggcgtatcgcttatccgaaaaaggagataccgtcttgctgtcaccagca
tgcgccagtttcgatctttttaaaaattacgaagatcgcggaagacaatttaaggaagca
gtgagaaatctatag

DBGET integrated database retrieval system