KEGG   Aerococcus urinaehominis: AWM75_00245Help
Entry
AWM75_00245       CDS       T04284                                 

Definition
(GenBank) hypothetical protein
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
auh  Aerococcus urinaehominis
Pathway
auh01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:auh00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    AWM75_00245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:auh01011]
    AWM75_00245
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:auh03036]
    AWM75_00245
Enzymes [BR:auh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     AWM75_00245
Peptidoglycan biosynthesis and degradation proteins [BR:auh01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   AWM75_00245
Chromosome and associated proteins [BR:auh03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    AWM75_00245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 SH3_3 SH3_4 SH3_16 SH3_1 SH3_2
Motif
Other DBs
NCBI-ProteinID: AMB98514
UniProt: A0A109RGB7
Position
complement(46995..48368)
Genome map
AA seq 457 aa AA seqDB search
MQKVKDHIKTNQNQYIIYLTLIAVLFALIGYDIYQHNKAHSRVIQSPVVNMRQGPSVTYD
IQEQVKAGSKYKVLDEKNDWTYIALNNGKVGWIPNWLSTGQLPDEANGFIATVIKDQAQL
YDASDQTNVVATADRNQKFPILHQDKGLVQIQLPQSIAWINQADIEITPGNMLNRGHYAM
DSETRLAYQEFLANYPASVNTNAEGVNLYSQADTNSEVITTLPNNEQMGYLGQDDIFYQV
ETIDGQVGYVANWLVTSNADVMAEAGKAARDQGALAGKTIVVDPGHGGEDPGAIDASESV
YEKENTLSTANYLKEALEAEGAKVIMTRQEDVLVDLAEIPQIANQAGADAFVSLHYDAAE
DLTRSGTTVYYYDEGLSYQLAQQVQAQLMEQGPLRSNGSHFGDYQVLRDNQRPAILLELG
YMSNPYDLSTFTQAEYQKTVAKAIVDGLACYLADQQA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagtaaaagaccatataaaaaccaaccaaaatcaatatatcatttacctgacc
ttgattgctgtcctctttgccctaattggatacgatatataccaacacaacaaggcccac
agccgggtcatccaatctccggttgtcaatatgcgccaggggccgagcgttacctatgac
atccaggagcaagttaaagccggcagcaaatataaggttctcgacgaaaaaaatgattgg
acctatattgccttaaataacggtaaagtcggctggataccaaattggttatcgaccggt
cagctacctgatgaggctaacggttttattgcgaccgtgatcaaagatcaggcccagctc
tacgatgctagcgaccagaccaatgtcgtggcaactgctgatcgtaatcaaaagttccct
attcttcatcaagataaggggctagtacaaattcaattgccacaaagtattgcgtggatc
aaccaagctgatatcgaaatcacccctggtaatatgcttaaccgaggacattatgccatg
gatagcgaaaccaggttggcctaccaagaatttttagccaattacccagctagcgtgaat
accaatgcagaaggcgtcaacctctatagccaagcagatacgaattcagaagtcattaca
accctacctaataatgaacagatgggctatctgggacaagatgatatcttctaccaagtt
gaaaccatcgatggccaagttggttatgtcgctaactggctagtcaccagcaatgccgat
gtcatggctgaagctggtaaagccgcccgtgatcaaggggctttagctggtaaaaccata
gttgtggatcccggtcatgggggtgaagatcctggtgccattgatgctagtgagagcgtc
tatgaaaaggaaaacaccctatccaccgctaattatctcaaagaagcgctagaagctgag
ggcgccaaagtaatcatgacccgccaagaagacgtgctggttgacctagctgaaattcct
caaatcgccaaccaggctggagccgatgcctttgtcagcctccactatgatgccgctgaa
gacctcacccggtccggaacgaccgtttattattatgatgaaggcctctcctaccagctc
gcccaacaggtccaagcccagctgatggaacaagggccactacggtctaacggtagccac
tttggcgactaccaggtgctaagagataaccagcgtcctgctattttgctggaactaggt
tatatgtctaacccatatgacttgtctaccttcacccaagctgaataccaaaaaactgtt
gccaaggccattgtggatggtctagcctgctatctagcagatcagcaagcttaa

DBGET integrated database retrieval system