KEGG   Aerococcus urinaehominis: AWM75_00310Help
Entry
AWM75_00310       CDS       T04284                                 

Gene name
glyQ
Definition
(GenBank) glycine--tRNA ligase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
auh  Aerococcus urinaehominis
Pathway
auh00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:auh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AWM75_00310 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:auh01007]
    AWM75_00310 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:auh03016]
    AWM75_00310 (glyQ)
Enzymes [BR:auh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     AWM75_00310 (glyQ)
Amino acid related enzymes [BR:auh01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   AWM75_00310 (glyQ)
Transfer RNA biogenesis [BR:auh03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AWM75_00310 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AMB98525
UniProt: A0A0X8FJK0
Position
59540..60457
Genome map
AA seq 305 aa AA seqDB search
MQAVQTVQDMILGLQNFWSQQNCLVLNAYDTEKGAGTMSPYTFLRAIGPEPWQACYVEPS
RRPADGRYGDNPNRVYQHHQFQVVMKPNPANIQELYIQSLEMLGIDPLAHDIRFVEDNWE
NPSLGCAGLGWEVWLDGMEITQFTYFQQVGGLACKPVTSEITYGIERLAMYLQEVDSIYD
LDWAPGVKYGEIFKQPEYEHSVYSFEKSNTDMLFAAFNQYEAEALAQIENNLVHPAYDYI
LKCSHTFNLLDARGVISVTDRAAYLARIRKMARQVAKAFVAERKKLGYPLLDEASAQALL
AEEEA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctgtacagaccgttcaagatatgattctgggcttacaaaatttttggtcccag
caaaattgcttggtgttaaatgcttacgatacagaaaaaggggcgggcacaatgagccca
tataccttcttaagagcgattggtccagaaccttggcaggcttgttatgttgagccttcc
cgccgacctgctgatggtcgctacggagataatcctaaccgggtttaccaacaccaccag
tttcaggtggtcatgaaacctaatcccgccaatatccaagagctctatattcaaagttta
gaaatgctcggtattgatccactggcccatgacatacgttttgttgaggacaactgggaa
aacccttcattaggttgtgccggattaggctgggaagtttggttagatgggatggaaatt
acccagtttacctacttccaacaggtcggcggtttggcctgtaaaccagtcacttctgag
attacttacgggattgagcggctagcgatgtatctacaagaagtggattctatttatgat
ttagactgggcaccgggtgttaaatatggcgaaatttttaagcaaccagaatatgagcac
tcagtttattcttttgaaaaatccaacaccgacatgctattcgctgctttcaaccagtat
gaagctgaagccttagcgcaaattgaaaataacctggttcatcctgcctatgattatatt
cttaagtgctctcatacattcaacctgctagatgcacgtggtgttatttctgtaactgat
cgggcagcctacctagcacgtattcgtaagatggctcggcaagtggccaaggcctttgtg
gcggaacggaagaaattgggttatccgttactagatgaagccagtgcccaagccttatta
gcagaggaggaagcctaa

DBGET integrated database retrieval system