KEGG   Aerococcus urinaehominis: AWM75_03010Help
Entry
AWM75_03010       CDS       T04284                                 

Definition
(GenBank) hypothetical protein
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
auh  Aerococcus urinaehominis
Pathway
auh00900  Terpenoid backbone biosynthesis
auh01110  Biosynthesis of secondary metabolites
auh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:auh00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AWM75_03010
Enzymes [BR:auh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     AWM75_03010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AMB99030
UniProt: A0A0X8FKK5
Position
703069..704397
Genome map
AA seq 442 aa AA seqDB search
MSSKRINYSKLSREDRIQSLVQLGYLNADQAQSLINNQGLSAQLADQMIENAVGSYGLPL
GFVPQLIVNHQDYLIPMATEEASVIAAASFGSQIINRNGGCQAEVTQSLLTGQIAFYGFD
PQDEDRLTEFVNQDQDRLLALANQVKPSLLARGGGARHIYTTFKGEASQGTRFFILYLDL
DSQEAMGANTMNTILEVLKDELVARFQDQINPEIQALMAILSNYSPQSLVTASCQIKGRQ
LKGGGLKGGQVAQRIALASQLAQVDRYRATTHNKGIMNGIDALVLATGNDWRAVEAGIHA
YASQDGHYRGLAQWSYDGEADLLTGQITLPLTLGTVGGSIANHPQAQINLDLLGRPTSQE
LMMVVAGLALAQNLAALRALVAEGIQAGHMSLQYRNLALQVGAQDQEVAELAQALKDSQI
PVSQDLARQILADMRAKQEDKS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaaagcgtataaactatagcaaactgagccgggaagatcgtattcagtcactg
gtgcaacttggctacctgaatgctgaccaggcccaaagtcttattaataaccaggggctg
agtgcccaattagcagaccaaatgattgaaaacgccgtgggcagctacggtctgccctta
ggctttgtcccccaattaattgttaaccaccaggactacctaatacccatggctactgag
gaggccagcgttatcgcagcagcctcttttggcagtcaaattattaaccgtaacggtggc
tgccaggctgaagtgacccagtcattattaactggtcaaattgccttttacggttttgac
ccccaagatgaagaccggctaactgaatttgtcaaccaagatcaagaccgcctgctggct
ttagccaaccaggtcaagcctagcctcctggcccggggtggtggtgcccgccatatctac
acaaccttcaagggggaagcctctcagggtacccgtttctttatcctctacctggacctg
gatagtcaagaagccatgggcgccaatactatgaatacgatattagaggtcttaaaagat
gagctagtcgcccgcttccaggaccaaatcaatcctgagattcaggctctgatggctatt
ctatcaaattacagtccccagtctttggtgactgccagctgtcaaatcaagggacgccag
ctcaagggtggtggtctcaagggcggtcaagtcgcccaacggattgccctggctagtcag
ttggcccaggtggaccgctaccgggctacgacccacaacaaggggataatgaatgggatt
gatgccctggtcttagccactggtaatgattggcgggcagttgaagccggtatccatgcc
tatgccagccaggatggccactaccgcggtctggcccagtggagttatgatggcgaggcc
gaccttctaactggccagatcacccttcccctcaccctgggaacagttggtggctcgatt
gccaaccacccccaggcccaaattaatcttgatctactcggtcgaccgactagccaagag
ctaatgatggtggttgctggcttagccctggcccagaacttagccgccctccgcgcccta
gtggctgaaggcatccaagctggccatatgagcctccaatatcgcaatctggccctacaa
gttggcgcccaagaccaagaagtagctgagcttgcccaggctctcaaagacagccaaata
ccagtcagtcaagaccttgcccggcaaatcctagctgatatgcgggcaaagcaagaggat
aaatcttaa

DBGET integrated database retrieval system