KEGG   Aerococcus urinaehominis: AWM75_05800Help
Entry
AWM75_05800       CDS       T04284                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
auh  Aerococcus urinaehominis
Pathway
auh00450  Selenocompound metabolism
auh00970  Aminoacyl-tRNA biosynthesis
auh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:auh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AWM75_05800
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AWM75_05800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:auh01007]
    AWM75_05800
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:auh03016]
    AWM75_05800
Enzymes [BR:auh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AWM75_05800
Amino acid related enzymes [BR:auh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AWM75_05800
Transfer RNA biogenesis [BR:auh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AWM75_05800
 Prokaryotic type
   Other AARSs
    AWM75_05800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f YihI DUF4455 ARL2_Bind_BART Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AMB99540
UniProt: A0A0X8FLJ9
Position
1275147..1277159
Genome map
AA seq 670 aa AA seqDB search
MTQANETFYITTPIYYPSGKLHIGNSYTTIACDVLARFKRMAGADVFYLTGTDEHGLKIQ
QKAEELGIKPQEYVDQMAADIKALWQRLGISNDKFIRTTDPEHVAAVQDMFEQLLAQGDI
YLGEYEGWYSVSDEEYFTESQLAEVYKDEDGKVIGGKAPSGHEVELVKEESYFFRMSKYA
DRLLQYYEDHPDFIQPESRKHEMINNFIKPGLEDLAVTRTSFNWGIPVKSNPKHVIYVWI
DALANYITALGYGSDDQALFDKYWPANVHMVGKEIVRFHTIYWPIMLMALDLPLPKQVFG
HGWLVMADGKMSKSKGNVVYPDMLVARYGLDALRYYLMREVRFGSDGVFTPENFVNRINY
DLANDLGNLLNRTVSMVNKYFDGQVGAYPGQITAFDADLENQIVQTINVYKKEMESLRFS
QALDHVWDLVARTNKYIDETEPWLLAKDDSRNDELQAVMYHLLDSLRIIAILIQPVLIET
PAKIFAQIGLNTDQAMTVEALNIGLYPKDAQVVAKGQPIFPRLDKEEEVAYIQDQMAQTG
AKSLDDADWQPEETNLVSVKEKQIKYDAFDKVELKVAEIIDCDFVAGADKLLKFRLDAGD
EGHRQILSGIREFYPEPERLIGKKVCIVANLKPRKMKGEISQGMILSAEHEGQLSLVFAP
SEAANGSVIA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
ttgacccaagcaaacgaaactttctatattaccactccgatttactatccaagtggtaag
ttacacattggtaattcttatacaactattgcctgcgatgtattggcccgttttaaacgt
atggctggggccgacgttttttatttaaccggaacggatgaacatggtttaaaaatccag
caaaaggctgaagaattagggattaaaccccaagagtatgttgaccaaatggccgcagat
atcaaggcgctttggcaacgactagggatttctaacgataaatttattcgaacaacggac
cctgaacacgtcgcagctgttcaggatatgttcgaacaacttcttgcccagggagatatc
tatttaggtgaatatgagggctggtattcagtgtctgatgaggaatactttacagagtcg
caattggccgaggtctataaggatgaagacggtaaggtgattggcggtaaggcaccatct
ggccatgaagtagagctagttaaagaggagtcttatttctttaggatgtctaaatatgct
gaccgcctcttgcaatactatgaggaccatcctgactttatccagcctgaatcacggaag
catgagatgattaataattttattaaacctggtttagaggatttagcagtgacacggact
tcatttaactgggggattcctgttaagtctaatcccaagcatgtcatctatgtctggatt
gatgctttagccaactatattaccgccctaggttatgggtcagatgatcaagcattattt
gacaagtattggccagctaatgtccatatggttggtaaggaaattgtgcgcttccacacc
atctattggccaattatgctaatggcgcttgacttaccactgccaaaacaagtttttggt
catggctggttggtgatggctgatggcaaaatgtctaaatctaagggtaatgttgtctac
cctgacatgttggtagcgcgttatggcctagatgctcttcgttattacttgatgcgggaa
gtacgttttggttctgatggcgtctttacaccagaaaattttgttaaccggattaactac
gacctagctaatgacttgggcaaccttcttaaccggactgtatctatggttaacaagtat
tttgatgggcaagtgggtgcttatcctggtcaaattactgcttttgatgctgacttagaa
aatcaaatcgtccagacaattaatgtttacaagaaagaaatggaaagtttacgctttagt
caagcacttgaccatgtctgggatttagtggcgcgtactaataaatatattgatgaaact
gagccttggcttttagctaaggacgatagtcgaaatgatgagctgcaagctgttatgtac
catttattagatagtttgcgcattattgcaattctgattcagccagttttaattgagacg
ccggctaagatttttgcgcaaattggcctaaatactgaccaagcaatgacggttgaggca
ttaaatattggtctctaccctaaagatgcacaggttgtggctaaggggcaacccatcttc
ccacgtttagataaggaagaagaagtagcctatatccaagaccagatggctcagacaggg
gccaaaagtctggatgatgctgactggcaacctgaggagactaacctagtatcagttaag
gaaaaacagattaaatatgatgcctttgataaagtagagctcaaagtggctgaaattata
gattgcgattttgtggcgggtgctgataaattgttgaaattccgcttagatgctggtgat
gaggggcatcgtcaaatcttgtctggtattcgggaattttaccctgaacctgaaagatta
attggtaaaaaggtttgtattgtagctaacctgaagccacgtaaaatgaagggcgaaatt
tctcaaggtatgattctatcagcagagcatgagggccaattatcactagtctttgcccct
agtgaggcagccaatggttcagtaatcgcctaa

DBGET integrated database retrieval system