KEGG   Aerococcus urinaehominis: AWM75_07100Help
Entry
AWM75_07100       CDS       T04284                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
auh  Aerococcus urinaehominis
Pathway
auh00620  Pyruvate metabolism
auh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:auh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWM75_07100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:auh02000]
    AWM75_07100
Enzymes [BR:auh01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     AWM75_07100
Transporters [BR:auh02000]
 Other transporters
  Primary active transporters [TC:3]
   AWM75_07100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Clathrin
Motif
Other DBs
NCBI-ProteinID: AMB99744
UniProt: A0A120IB04
Position
1508307..1509701
Genome map
AA seq 464 aa AA seqDB search
MSKQIKIVETVLRDGHQSLAATRMSTEQMIPILEQMDQAGYYALECWGGATFDAALRFLN
EDPWERLRLIRKHTPNTKLQMLLRGQNLLGYRNYPDDVVERFIQKSIENGIDIIRVFDAL
NDLRNLETAFAATKKYGGHLQATICFTTSEVHIDDYFVDLAVKMSRMGADSICVKDMAGI
LTPQRAYDLVSKIKAVVSLPLEVHTHATAGTVSMTYLKAIEAGCDIIDTAISPFAGGTSQ
PATESLHVALTEMGYDDGLDTDTLGEIADYFSGIRDDFRAEGLINPRVMEVVPETLLYQV
PGGMLSNLLSQLDQAGQADKFTEVLKEVPRVRADLGYPPLVTPLSQMVGTQSVMNVLTGE
RYKMVPNEIKDYVKGYYGKSPAPISADIRQQIIGDEEVITQRPADLLAPGYDKAKQELGD
LAESAEDVLSYIAFPQPALDFLNRRRDPWYDVPVQEVTVTLDPQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaaattaaaatagttgaaacagttctccgggatggccaccaatctttggcg
gcgactcggatgtcgactgaacagatgatacctattctagagcaaatggaccaggctggt
tactatgctttggaatgctggggtggggctacctttgatgcagccttacgctttttaaac
gaagacccttgggagcggctacgcttaattcgtaaacatacccctaatacaaaattacaa
atgcttttgcggggccaaaacctgctaggctatcgtaattatccagatgatgtggtagag
cgatttatccaaaaatcaatcgaaaatggtattgatattattcgggtttttgacgctctt
aatgacctacgtaatttagaaacggcttttgctgcaactaaaaaatatggtggtcacttg
caagcaaccatttgctttacgacttcagaagtgcatattgatgactattttgtggatctt
gcagttaaaatgagtcgtatgggtgctgattccatctgcgttaaagatatggcgggtatt
ttaaccccgcaacgggcctatgaccttgtcagcaaaatcaaagcagttgtcagcttacca
cttgaagtccatactcatgctactgcaggcaccgtttcaatgacttatctaaaagcaatt
gaagctggctgtgatattattgatacggctatttctccatttgctggtggtactagccaa
ccagcgactgagagcttgcatgtggccctgaccgaaatgggttacgatgatggtttggat
accgatacgctgggtgaaattgcagattacttcagtggaatccgcgatgattttagggct
gaaggactgattaacccacgggtcatggaagttgttcctgaaaccttattatatcaagtg
ccaggcggtatgttatctaacctcttgtcgcaattagaccaagcgggccaggctgataag
tttaccgaagtccttaaagaggtgccgcgcgtccgggctgacctgggttatccaccgcta
gtgacgccattatcacagatggttggtacccaatcagttatgaatgtcctgactggtgaa
cggtacaagatggttcctaatgagattaaggattatgtcaaaggctattatggtaaatca
ccagcgccaatcagtgctgacattcgccaacaaattattggtgatgaagaggtcatcacg
caaagaccagctgacctattagcacctggttacgataaggccaagcaagaacttggcgac
ctagctgaatcagcggaagatgttttatcttatattgctttcccacaaccagctttggac
ttccttaatcgtcgccgtgatccatggtatgatgtgcctgttcaagaggttacggttacc
ttggatccgcaataa

DBGET integrated database retrieval system