KEGG   Aerococcus urinaeequi: APT62_04770Help
Entry
APT62_04770       CDS       T04249                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aui  Aerococcus urinaeequi
Pathway
aui00071  Fatty acid degradation
aui00072  Synthesis and degradation of ketone bodies
aui00280  Valine, leucine and isoleucine degradation
aui00310  Lysine degradation
aui00362  Benzoate degradation
aui00380  Tryptophan metabolism
aui00620  Pyruvate metabolism
aui00630  Glyoxylate and dicarboxylate metabolism
aui00640  Propanoate metabolism
aui00650  Butanoate metabolism
aui00900  Terpenoid backbone biosynthesis
aui01100  Metabolic pathways
aui01110  Biosynthesis of secondary metabolites
aui01120  Microbial metabolism in diverse environments
aui01130  Biosynthesis of antibiotics
aui01200  Carbon metabolism
aui01212  Fatty acid metabolism
aui02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APT62_04770
   00630 Glyoxylate and dicarboxylate metabolism
    APT62_04770
   00640 Propanoate metabolism
    APT62_04770
   00650 Butanoate metabolism
    APT62_04770
  09103 Lipid metabolism
   00071 Fatty acid degradation
    APT62_04770
   00072 Synthesis and degradation of ketone bodies
    APT62_04770
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APT62_04770
   00310 Lysine degradation
    APT62_04770
   00380 Tryptophan metabolism
    APT62_04770
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APT62_04770
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APT62_04770
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    APT62_04770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aui04147]
    APT62_04770
Enzymes [BR:aui01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     APT62_04770
Exosome [BR:aui04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APT62_04770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALZ87813
UniProt: A0A0U4WI73
Position
1058040..1059221
Genome map
AA seq 393 aa AA seqDB search
MEEVVIVAAKRSAIGKFGGQFKSISAVDLGVEVLKETLASIDLDPKKVEQVILGNVLSAG
LGQNVARQVALKSGLSNESTAVTINQVCGSGLRTVMMGAQAIMLGDADIVVAGGTENMTR
APYVVDSARWGQRMGNGQMIDTMQHDGLTDAFSNDAMGITAENIADQYGISREAQDEFAA
ASQIKAVAAKEADRFAEEIVPVTIPQKNGVQVVTEDEGPRSGITPKRLGKLQPAFKEEGT
VTAGNSSGINDGAAMLVLMSKRKADELGLKPMVSIASYATGGVDPSIMGTGPIPTTIKAL
EMANITAGDLDLIEANEAFASQALCVTTSLELPADKVNVNGGAIALGHPIGASGARILVT
LIHEMLKRQSVYGLATLCVGGGQGVSVIVKQAI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagtagtcattgttgcagcgaaacgttctgcaatcggaaaatttggtggccaa
tttaaaagcatttcagcagttgatttaggggtagaagtattaaaagaaacactcgcttca
attgatttagacccaaaaaaagttgaacaagtgatcttggggaatgtattaagtgctgga
cttggccaaaacgttgcgcgccaagtcgccctaaaatcaggtttgtctaacgaatctact
gccgtaaccattaaccaagtttgtggttcaggattgcgtactgtcatgatgggcgcacaa
gctatcatgcttggcgacgctgatattgtggtcgcaggtggtacggaaaatatgactcgt
gcaccatacgtggttgattccgctcgttggggtcagcgtatgggcaatggtcaaatgatt
gacactatgcaacacgatggtctaactgatgccttctcaaacgacgcgatggggattaca
gcagaaaatattgcggaccaatacgggatttcccgtgaagcccaagatgaatttgcagcc
gctagccaaatcaaggctgtagcagcgaaagaggctgatcgttttgcagaagaaattgtc
ccagtgaccatcccacaaaaaaatggcgtgcaagtagtgactgaagatgaagggccacgt
tcgggtattacaccaaaacgtttgggtaaattgcaaccggcctttaaagaagaggggaca
gttacagcaggtaactcatcaggtatcaatgacggggcagcaatgcttgtcttaatgtct
aagcgtaaggccgatgaactagggcttaaacccatggtatccattgcatcttacgcaacg
ggtggggtagatccttcaattatggggacaggtccaatcccaacaacgatcaaggcctta
gaaatggccaatattacagcaggagacctagatttaattgaggcaaatgaagcgtttgca
tcccaagctttatgtgtaaccacaagcttagaattgccagctgacaaagttaacgtgaat
ggtggggcaattgcccttggtcatccaatcggtgcttcaggcgcccgtattttggttacc
ttgatccatgaaatgctaaaacgtcagtcagtttatggtttagcgaccctatgtgtgggc
ggcggacaaggggtatccgtcatagtaaaacaggcaatttaa

DBGET integrated database retrieval system