KEGG   Aerococcus urinaeequi: APT62_07065Help
Entry
APT62_07065       CDS       T04249                                 

Definition
(GenBank) hypothetical protein
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
aui  Aerococcus urinaeequi
Pathway
aui00010  Glycolysis / Gluconeogenesis
aui00030  Pentose phosphate pathway
aui00051  Fructose and mannose metabolism
aui00680  Methane metabolism
aui01100  Metabolic pathways
aui01110  Biosynthesis of secondary metabolites
aui01120  Microbial metabolism in diverse environments
aui01130  Biosynthesis of antibiotics
aui01200  Carbon metabolism
aui01230  Biosynthesis of amino acids
Module
aui_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APT62_07065
   00030 Pentose phosphate pathway
    APT62_07065
   00051 Fructose and mannose metabolism
    APT62_07065
  09102 Energy metabolism
   00680 Methane metabolism
    APT62_07065
Enzymes [BR:aui01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     APT62_07065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase RVP_2
Motif
Other DBs
NCBI-ProteinID: ALZ88221
UniProt: A0A0U4X0N6
Position
complement(1547717..1548583)
Genome map
AA seq 288 aa AA seqDB search
MLITMSEMLKVAKENQFAVGAYNISDANIFKAVVEKAEELEAPAIIAIHPDELSFITNEF
IAYIKERTENSKVPFVLHLDHGGSLEDVINAISCGFTSVMIDGSHLPYEENIEITKKAAD
IAHAVGVSVEGELGTIGDTGTSIEGGVTEITYTVPAEADEFIQRTGIDTLAIAIGTAHGI
YPKDFIPKLKLDILKEVSQLVDTPLVLHGGSSNSDREIAQAVEIGIQKINISSDTKKAYF
KRLQELLDSDVMWEPNALFPPCIESAKEVVEHKMNLFNSVNKAKLFYS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgttaattacaatgtcagaaatgcttaaagtagctaaagaaaaccaatttgctgttggt
gcatataatatttcagacgccaatattttcaaagctgtagtagagaaggcggaagaacta
gaagcgcctgcaatcattgccattcatccagatgagttaagctttattaccaatgaattt
attgcctatatcaaggaacgaaccgaaaattctaaagtaccatttgtcctacatttagac
catggtggctcactagaagatgtcattaatgctatttcttgtggctttacctcagttatg
attgacgggtctcatctaccatatgaagaaaatattgaaatcaccaaaaaggcagctgac
attgcacatgcagtaggggtttcagtcgaaggggaattagggacgattggtgatacaggt
acctccatcgaaggtggggtaactgaaataacctatacagtaccagctgaagcggatgaa
tttatacaacggactggcattgatacattggccattgctattggaacagcacacggtatt
tatcctaaagactttatccctaaattaaaacttgatatcttgaaagaagtgagtcaattg
gtggataccccattagttttacacggtggatcatcaaactctgatcgtgaaattgcccaa
gcagtcgaaatcggtattcaaaaaatcaacatttcgagtgatacgaaaaaagcctatttt
aaacgactacaagaattgctggattcagacgtgatgtgggaaccgaatgctcttttccca
ccatgtatcgagtcagctaaagaggtcgtagaacataagatgaatttgttcaattcagtc
aataaagcaaaactattttatagttag

DBGET integrated database retrieval system