KEGG   Aerococcus urinaeequi: APT62_08530Help
Entry
APT62_08530       CDS       T04249                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aui  Aerococcus urinaeequi
Pathway
aui00520  Amino sugar and nucleotide sugar metabolism
aui01100  Metabolic pathways
aui01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:aui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    APT62_08530
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    APT62_08530
Enzymes [BR:aui01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     APT62_08530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ALZ88484
UniProt: A0A0U4XAA2
Position
complement(1842368..1844185)
Genome map
AA seq 605 aa AA seqDB search
MAKVDLTKQPYNLDAEGVKWVEDTIANMTIDEKIGQLFFNMGASTEPEYLKDVLDTYHIS
GVRYNKSKADVVYEQNKVLQGHSKYPVLIAANTEAGGDGAANDGTYIGHEVKIAATNDSK
YAYEMGRIAGVEAAAIGCNMSFAPIVDITENWRNPIISVRTWSNDTEKVLENSLAYLKGI
SEEGILATAKHFPGDGNDERDHHFSFATNHSTLEEWFESFGKVYKGLIDAGLPAIMAGHI
GLPSYVEKVNPSASLSEKNLPATLSRELLTDLLKGELGFNGAVITDASHMVAFTSALKRE
DALPTSIAAGCDMFLFFNDPDEDFAWMKAGYENGTITDERLNDAISRTLGLRAKLGLHKV
DRTQILAPKEEALAKIATDEHKEMAREVADQAITLVKNEQPDVFPVTPERYKSVLLVLNE
GVKGGFGAMIASKESPVDIMKAKMEERGFNVTVWESTEERIMKLPEAERAAAIANVYAQK
QPIAKLTNQYDLVINLAKIAAGTVQRVAWPASKGTPDIPFYVNEIPTIYVSVNHPFALAD
VPQVQTYINAYDDKDFNIEILVDKLAQGPEAFKGVDPVDSFTGFEDTRYSSADVYANRIN
PAKTK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagttgatttaactaaacaaccctataatttagacgcagaaggtgtcaaatgg
gttgaagatacaatcgcaaatatgacaattgacgaaaaaattggtcaattattctttaat
atgggtgcaagtactgaacctgaatacttaaaagatgtattagatacttatcacatctca
ggtgtacgttacaacaaatctaaagcagatgttgtttatgaacaaaataaagtattacaa
ggccactctaaatacccagtattaatcgctgcgaacactgaagctggtggtgacggtgct
gctaacgacggtacttatatcggtcacgaagtgaaaattgctgctactaacgactctaaa
tacgcttatgaaatgggccgtattgctggtgttgaagctgctgcaatcggatgtaacatg
tcatttgcaccaatcgtagatattactgaaaactggagaaacccaattatctcagtacgt
acttggtcaaacgacacagaaaaagttttagaaaactcattagcatacttaaaaggtatc
tcagaagaaggtatccttgcgactgctaaacacttcccaggtgatggtaacgacgaacgt
gaccaccatttttcatttgcgactaaccactcaacattagaagaatggtttgaatcattt
ggtaaagtttacaaaggattaatcgacgcaggtttaccagcaatcatggctggacacatt
ggtttaccttcatatgtagaaaaagtaaacccatctgcttcattatctgagaaaaactta
ccagctacattatcacgtgagttattaactgacttattaaaaggtgagttaggctttaac
ggtgcggtaattacagatgcttcacacatggttgcatttacaagtgcattaaaacgtgaa
gatgcactaccaacttctatcgctgctggttgtgacatgttcttattcttcaacgatcca
gatgaagactttgcatggatgaaagctggttacgaaaacggtacgatcactgacgaacgt
ctaaacgatgcgatttctcgtactttaggtttacgtgctaaactaggtttacacaaagtt
gaccgtactcaaatcttagcgcctaaagaagaagcgttagctaagattgctactgacgaa
cataaagaaatggctcgcgaagttgctgaccaagcgattactttagttaaaaatgaacaa
ccagatgtgttccctgtaacacctgaacgctacaagtctgtattattagtacttaacgaa
ggtgttaaaggtggattcggtgcgatgattgcttctaaagaatctccagtagacattatg
aaagctaaaatggaagaacgtggctttaacgtaactgtttgggaatcaacagaagaacgt
atcatgaagttaccagaagctgaacgtgcagcagcgattgctaacgtttatgctcaaaaa
caaccaattgctaaattaacaaaccaatatgatttagtaattaacttagctaagattgct
gcaggtacagtacaacgtgttgcatggccagcatctaaaggtacaccggatattccattc
tacgtaaacgaaattcctacaatttacgtatcagtgaaccatccatttgcattggcagat
gtgcctcaagtacaaacttacatcaatgcatacgacgataaagacttcaatattgaaatc
ttagtcgacaaattagctcaaggtcctgaagcatttaagggtgttgacccagttgattca
ttcactggcttcgaagatactcgttattcttcagctgacgtatatgctaaccgtatcaac
ccagctaaaactaaataa

DBGET integrated database retrieval system