KEGG   Auritidibacter sp. NML130574: DCC27_004735Help
Entry
DCC27_004735      CDS       T05590                                 

Definition
(GenBank) mycothione reductase
  KO
K17883  mycothione reductase [EC:1.8.1.15]
Organism
aul  Auritidibacter sp. NML130574
Brite
KEGG Orthology (KO) [BR:aul00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DCC27_004735
Enzymes [BR:aul01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.15  mycothione reductase
     DCC27_004735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 K_oxygenase AlaDh_PNT_C 3HCDH_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AXR73722
Position
complement(1045751..1047202)
Genome map
AA seq 483 aa AA seqDB search
MSVEHYDLAIIGSGSGNSVITESWDDKKVAMIDSGVFGGTCLNKGCIPTKMYVYPSTVAS
TPEPAAEVNVDVSFNGADWSGLRDRVFSRIDAISDSGRAYRDEELEHTTLIAEEVHFTGP
RQLTSASGRVIEAEQIVIAAGSRPRIPDVPGVDLPQVHTSDTVMRLEQLPEHILIIGGGY
IAAEFAAIFSGLGSTVHQVNRSPRLLRHQDEEISAAFTQRAQEQWQLTTGYTLNGIRQTD
GDQVVADFTAVNTEENSADQSQSADLSVQTDVVLIATGRVPNTDRLNLTAAGIDTNEHHR
ISTDPYLRVLSNGEVLPGVWALGDITNDHQLKHVANHEQRVVNHNMDHPDQLKPARLDPV
PAAVFSRPQIASAGLTEAQARAQYGDDDLTIKVQQYADVAYGWAMGDAFGFVKLIAQRST
GTLLGAHLIGEDSSNLIQPLVQAMSLGIDAHTMARGQYWIHPALAEVVENALLGLEVPDS
GLV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgaacattacgatttagcgattatcgggtctggttctggaaactcggtgatc
accgagagctgggatgacaagaaggtcgccatgatcgattccggggtatttggtgggacc
tgtctgaataaagggtgtatccccaccaaaatgtatgtctatccttccaccgtggcctcc
accccagaacctgccgcggaggttaacgtcgatgtcagtttcaatggggctgactggtcg
ggactgcgagacagagtattctcccgcattgacgcgatctctgactcagggcgtgcctac
cgcgatgaagaactcgaacacacgactctgattgctgaagaagtccatttcaccggacca
cgccagctcaccagcgcatcgggtcgggtgatcgaagccgaacagatcgtgattgccgcc
gggtcgcgtccgcggattcctgacgtgcccggtgtggatctgccacaggtccacacctcc
gatacggtgatgcgtctcgaacaattgcctgagcacatcctgatcattggtgggggatat
atcgccgccgaatttgccgccattttttccggtctcggttcgaccgtgcaccaggtcaac
cgcagtccccggcttttacgtcaccaggatgaggagatctcggcggcctttacccaacga
gcccaggaacaatggcagctcaccaccgggtatacactcaacggtatccgccaaactgac
ggggatcaggtggttgctgattttactgcagtcaacaccgaagagaactctgccgatcag
tcccagagcgcggatctcagtgtgcaaaccgatgtggtgctgatcgccaccggccgggtg
ccgaataccgaccgactgaacctgaccgccgccggcattgataccaacgaacaccaccgc
atttccaccgacccgtatttacgggtgctctccaacggtgaggtattgcccggggtctgg
gcgctgggcgatatcaccaatgaccaccagctcaagcacgtggccaatcacgaacagcgg
gtggtcaatcacaatatggaccacccggaccagcttaagcccgcccggctggacccggtt
ccggccgcagtgttctcccggccccaaatagccagtgctggactcaccgaggcacaggcc
cgcgcccaatacggcgacgatgatctcacgatcaaggtccagcagtacgccgatgttgcc
tatggttgggcgatgggagatgccttcggcttcgtaaaactcattgcccaacgcagtacc
ggaaccctgttaggtgcccacctgatcggtgaggactcctcaaacctgattcagccgttg
gttcaagcaatgagcctcggcatcgacgcccacacgatggcacgcggccagtattggatt
cacccggctttggcggaagttgtcgaaaacgcactgctgggtttggaggtcccggattcc
gggctggtctga

DBGET integrated database retrieval system