KEGG   Auritidibacter sp. NML130574: DCC27_006410Help
Entry
DCC27_006410      CDS       T05590                                 

Gene name
uppS
Definition
(GenBank) di-trans,poly-cis-decaprenylcistransferase
  KO
K12503  short-chain Z-isoprenyl diphosphate synthase [EC:2.5.1.68]
Organism
aul  Auritidibacter sp. NML130574
Pathway
aul00900  Terpenoid backbone biosynthesis
aul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aul00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DCC27_006410 (uppS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:aul01006]
    DCC27_006410 (uppS)
Enzymes [BR:aul01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.68  (2Z,6E)-farnesyl diphosphate synthase
     DCC27_006410 (uppS)
Prenyltransferases [BR:aul01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   DCC27_006410 (uppS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-ProteinID: AXR73995
Position
complement(1410666..1411445)
Genome map
AA seq 259 aa AA seqDB search
MDYPDLFYRLYERRLAQGLDASRLPGHIGVVLDGNRRWAKAAGEPTARGHQAGADKILEF
LGWSAEIGIPMVTLYMLSTDNLNRDASELRSLVAIISDTLKRLEEGEINGRPIKVQPVGS
TEILPASLSEQIRHLTRRGAQHNESGMHVNVAVGYGGRQEIVDGVKELLIEAEEQGQTPG
DVAEKLSIEEISNRLYTRGLPDPDLVIRTSGEQRLSGFLMWQSAYAEFYFCEALWPDFRR
VDFLRALRDYASRQRRYGS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggactatcccgacctgttttatcgactttacgagcgccggttagctcagggccttgac
gcctcccgtttgcccgggcatatcggtgtcgtcctggacggcaaccggcgctgggcgaaa
gccgcgggggagcctactgcccggggtcaccaagccggtgccgataagatcctcgagttt
ttggggtggagcgcagagatcgggatcccaatggtaactctctatatgctctccaccgat
aatctgaatcgggatgcctccgagctgaggtccctggtcgctattatttccgatacgctc
aaacggctggaagaaggcgaaatcaacggtcggccgatcaaagtccaacccgtggggtcg
accgagattttgccagcatcgctctccgaacaaatccgtcaccttacgcggcgcggtgcc
caacacaatgaatccgggatgcacgtgaacgtggcagtcggttacggcggtcgtcaagaa
atcgtggacggggtcaaagagcttctaatcgaagccgaagaacaaggccaaacccccggt
gacgtggcggaaaaactcagcatcgaagaaatctcgaatcgactgtacacccgaggtctt
ccggaccccgacctggtgattcggacctccggtgaacagcgactctccggatttttgatg
tggcagtcagcctacgccgaattttacttttgtgaagctctatggcctgattttcggcgg
gttgatttcctgcgtgccctgcgtgattatgcctcacgacagcgccggtacgggagttaa

DBGET integrated database retrieval system