KEGG   Auritidibacter sp. NML130574: DCC27_006935Help
Entry
DCC27_006935      CDS       T05590                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aul  Auritidibacter sp. NML130574
Pathway
aul00020  Citrate cycle (TCA cycle)
aul00480  Glutathione metabolism
aul01100  Metabolic pathways
aul01110  Biosynthesis of secondary metabolites
aul01120  Microbial metabolism in diverse environments
aul01130  Biosynthesis of antibiotics
aul01200  Carbon metabolism
aul01210  2-Oxocarboxylic acid metabolism
aul01230  Biosynthesis of amino acids
Module
aul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aul_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DCC27_006935
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DCC27_006935
Enzymes [BR:aul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DCC27_006935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AXR75105
Position
complement(1520133..1522358)
Genome map
AA seq 741 aa AA seqDB search
MSKIIYTHTDEAPMLATASLLPIVRAFASTAGVELETRDISLAGRVLAAFNDVLPEQQRT
NDALGELGELVKEPEANVIKLPNISASVPQLVATIKELQQAGYELPDYPDEPATEEQKDA
RARYDSVKGSAVNPVLREGNSDRRAPRAVKNFAKKHPHSMGEWSADSQTNVATMHDHDFV
SNEQSVTMDSDDVLTIRHTDADGNVTILKDELKVLKGEIVDATFMSARALDDFLADQVAK
AKEQGVLFSAHLKATMMKVSDPVIFSHVVKAYFPELFEKYGDQLAAAGLSATNGLASIEN
GLDQLDDQTAEGIKQAIADGYANGPDLAMVNSHKGITNLHVPSDVIIDASMPAMIRTGGQ
MWNKNDETQDTLAVIPDSSYAGVYQTVIDDCRANGAYDPTTMGTVPNVGLMAQKAEEYGS
HDKTFIQDKAGIVEIINSDGDVLTSHQVEAHDIWRACQTKDIPVRNWVKLAVTRARASKT
PAVFWLDAERAHDAQLIAKVKEYLPENDTDGLDLRILAPEEATRFTLERIRAGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLINGGGLFETGAGGSAPKHVQQFVEENHLRWD
SLGEFLALAVSFEHLAQSFDNSRAQVLGDTLDAATGTFLEEGRSPSRRAGEIDNRGSHFY
LALYWAEELAAQTDDQPLADAMKDVASKLRAKEDQIMEELNSVQGEPVDIAGYYYPSVEK
ISAAMRPSETLNSIISSLDQR
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagattatctatactcacaccgatgaggcccccatgctcgccacagcatcgctg
ttgccgatcgtgagggcttttgcgtccaccgccggtgttgagctggagacgcgcgatatc
tccctggccggacgtgtgctggctgctttcaacgacgtcctgcccgaacagcagcgcacc
aatgatgcgttgggcgaactgggtgaattggtcaaagaacccgaagcaaacgtcatcaag
cttcctaatatctccgcctccgtcccgcagctggtggccaccatcaaagaactgcaacaa
gccggctacgagttgccggactaccctgacgagcctgccaccgaggaacagaaggatgct
cgggcccgctatgactcggtcaaagggtcggcggttaacccggtgctgcgcgaaggaaat
tcggaccgtcgcgccccgcgggcggtcaaaaacttcgccaagaagcacccgcattccatg
ggggagtggtctgcggactcccagaccaacgtcgccaccatgcacgaccatgacttcgtc
tccaatgagcaatcggtgaccatggattccgacgatgtgctcaccattcggcataccgac
gctgacggcaatgtcaccatcctgaaagacgagctcaaagtcctcaagggcgagatcgtg
gatgccaccttcatgtcggcccgtgccctggatgactttttggcagatcaggttgccaaa
gccaaagagcagggcgtgctgttctccgctcacctgaaagccaccatgatgaaggtctcc
gacccggtgatcttctcccacgtggttaaggcctacttcccggagttgtttgaaaaatat
ggtgaccagctggccgctgccgggctatcggccaccaacgggctggcttcgatcgaaaac
ggtttggaccagctggacgaccagaccgctgaaggcatcaaacaggcgattgctgatggc
tacgccaacggcccggatttggccatggtcaattcgcataagggcatcaccaatctccac
gttccctcggatgtgatcatcgatgcctccatgccggcgatgattcgcaccggcggccag
atgtggaataaaaacgatgaaacccaggacaccttggctgtgatcccggattcctcctat
gctggcgtttaccagaccgtgattgacgactgccgtgccaacggcgcctacgatccgacc
accatgggcaccgtgcccaatgtggggctgatggcacagaaggctgaagagtacggttct
cacgacaagacctttatccaggacaaggccggcatcgtggagatcatcaactcggacggg
gatgtattaacaagccaccaggtggaagcacatgacatctggcgggcctgccagaccaag
gacatcccggtgcgcaactgggttaagcttgcagtcacccgcgcccgggcctcgaagact
ccggcggtcttctggttggacgctgagcgcgctcacgatgcacagctgattgccaaagtc
aaagagtacctacccgaaaatgacaccgacggactggatttgcgcatcctggcacccgaa
gaggccacgcggttcaccctggagcggatccgtgccggtgaagataccatttcggtaacc
ggtaacgtgctacgcgactacctcaccgacctgtttcccatcctggagctgggtacctcg
gcgaagatgctctcgattgttccactgattaatggtggcgggctcttcgagaccggtgcc
ggcggatcggctcccaagcacgtccaacagttcgtggaagaaaaccacctgcgctgggat
tcactgggtgaattcttggccctggccgtctccttcgaacacctggcccagtccttcgac
aactcccgcgcccaggtgctcggcgatactctggatgccgccaccggaaccttcttggaa
gaagggcgttccccgtcccgtcgagccggggagattgacaaccgtggctcccacttctat
ctggcgctgtactgggctgaagaactggcagcccagaccgatgaccagccgctggctgat
gccatgaaggatgtcgcttccaagctacgggccaaggaagaccagattatggaagaactc
aatagcgtccagggtgagccggtggatatcgccgggtactactacccctcggtggagaag
atttctgctgctatgcgtccctccgaaacgctcaacagcattatctccagcctcgaccag
cgctaa

DBGET integrated database retrieval system