KEGG   Auritidibacter sp. NML130574: DCC27_011055Help
Entry
DCC27_011055      CDS       T05590                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
aul  Auritidibacter sp. NML130574
Pathway
aul00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:aul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DCC27_011055
Enzymes [BR:aul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DCC27_011055
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DCC27_011055
    1.1.1.-  
     DCC27_011055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AXR74754
Position
2435940..2437016
Genome map
AA seq 358 aa AA seqDB search
MRAARYYDQKDIRIDDIDAPEAQSGQVLIDVAWCGICGSDLHEYLEGPLSIPPAGHPHPI
SGEEAPVTIGHEMSGTVAALGDGVTDLEIGQQVVVEPYVIEEKYKNTANYNLSPNMGFIG
LVGRGGGLAEQIAVDRHWVHPISDDVPLDQAAMIEPLSVAHHAYVNSQAQSGDIALIGGA
GPIGVLTTAVLKAEGITTIVSEPSDLRRNRAEESGVADYVLDPRNDDVVEEVLKITDGRG
VDVGFECSSVPVVLDTLIEAVRPAGTIVNVSVWSSKPEVNMPKLVLKEIKLAGVIGYCND
HKDTIDLVESGKIDLKPFITGKIGLDDLIDKGFDALINHNESAIKILVSPSGQGLDEV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcgcgttattatgatcaaaaagatatccgaattgacgacatcgatgcccct
gaggctcagtctggccaggtactgatcgatgtggcgtggtgtggcatctgtggcagtgac
ctccatgaatatcttgaaggacctctttcgattcctccggccggacatccacacccgata
tctggtgaagaagctccggtcacgataggacacgagatgtccggaaccgtggccgctctg
ggcgacggtgtgactgatctcgagattggtcagcaggtcgtcgtcgagccctacgtcatt
gaggaaaagtacaaaaataccgcaaactataatttgtctccgaacatgggctttattggt
ttggtcggccgcggtggtggtcttgcggaacagattgccgtggaccgtcactgggttcac
ccaatttcggatgacgttcctctggaccaggcagccatgatcgagcccttgtcggtcgct
catcacgcgtacgtgaattctcaggctcagtctggtgatattgcattaattggtggagcc
ggaccgatcggcgtactcacgaccgccgtgctaaaggctgaaggaatcaccaccatcgtc
tctgagccctcggatctgcgtcgcaaccgggctgaagaaagcggtgtcgccgattacgtc
ttagaccctcgcaacgatgatgtggtcgaggaagttctgaagatcaccgacggtcggggc
gttgacgtgggcttcgagtgtagctcagtgccggtggtcctcgatacattgattgaggct
gtccgcccggccggcacgattgtgaacgtttcggtctggagctctaagccggaggtcaac
atgccgaaattggttctgaaagagatcaaactggctggggtgatcggttactgcaacgac
cacaaagacaccatcgatcttgtcgaatcgggcaagattgacctcaagcccttcatcacc
ggaaagattggtttagacgatctgatcgacaaagggttcgatgcgttgatcaaccacaat
gaatccgcgattaaaattctggtctcaccatcgggccagggcctcgacgaggtgtaa

DBGET integrated database retrieval system