KEGG   Aurantimicrobium sp. MWH-Mo1: AURMO_00535Help
Entry
AURMO_00535       CDS       T05480                                 

Definition
(GenBank) Low-affinity inorganic phosphate transporter 1
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
aum  Aurantimicrobium sp. MWH-Mo1
Brite
KEGG Orthology (KO) [BR:aum00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AURMO_00535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AWR21148
UniProt: A0A2Z3S2A4
Position
507223..508476
Genome map
AA seq 417 aa AA seqDB search
MDPLFVVVLVVALALFFDFTNGFHDTANAMATPIATGALKPRTAVLIAAVLNLVGAFLST
AVAKTISVDLINEDVTIKVEMIFAGLCGAILWNLTTWILGLPSSSSHALFGGLIGAAIAS
AGFDAVNFIKVVEKVILPSLFAPVIAGVAAYLATKLAYIITARSQAERARTGIGTGRSRF
RTGQIFSSTLVALSHGTNDAQKTMGVITLVLITAGVLGKDSGVPLWVMIAAALAIALGTY
MGGWRIIKTMGTGLSEIKPAQGLAAETATGVTILASTNLGFALSTTQVASGSVIGAGLGR
KGGTVRWNKASHVVGAWFLTLPAAAIVGAFAAWIAGTGPFGILVDAVLVTGVIIALFQIS
KRNAVTHTNVLSEVEGASEIVETPAQRRRAEKAAKLAAKKAAEKAAKQAKKNKKGKN
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggatcctctattcgtcgtcgtgctcgttgtagcactcgcgcttttctttgacttcacc
aacggtttccatgacaccgcaaacgcaatggcaacccctattgcaactggtgcgctcaag
cctcgtaccgctgttctcattgcagcggtgttgaaccttgtaggtgcattcctttccact
gcggtggcaaagaccatctcagttgatctcattaatgaagacgtcaccatcaaggtggaa
atgatttttgccggtttgtgtggtgcgatcttgtggaacctcaccacgtggatcttggga
ttgccctcctcttcgtcacacgcactctttggtggactgattggtgcggctatcgctagt
gctggtttcgatgcggtcaacttcatcaaggttgtggagaaggtcatccttccttccctc
ttcgcccctgtgattgctggtgtggctgcctacctggctaccaagcttgcctacatcatt
actgcgcgttcgcaggcagagcgtgctcgtactggaatcggtacaggacgttcacgcttc
cgcaccggacagatcttctcgtccacgctggttgcgctttcgcacggtactaacgatgct
cagaagaccatgggtgtgatcacgttggttcttatcaccgctggtgtgctcgggaaagac
agtggcgttccgctatgggtcatgattgcagcagctcttgctattgcactcggcacctac
atgggtggatggcgcatcatcaagaccatgggaactgggctttctgaaattaagccagcc
caaggtcttgccgccgaaaccgcaaccggtgtcaccatcttggcctcgaccaaccttggt
tttgctctctcgacaactcaggttgcgtcaggatctgttattggtgcaggcctgggccgt
aagggtggaactgtccgctggaacaaggcaagccacgtcgttggcgcatggttcctcacc
ctccctgctgctgccatcgttggagcgttcgcggcatggattgcaggaacgggtcccttc
ggaatcttggttgacgcagttctcgttaccggtgtcatcatcgcgttgttccagataagc
aagcgcaatgccgttacccacaccaacgtcctctctgaggtcgagggtgcgagcgaaatc
gtggaaactcctgcacagcgtcgccgtgcagagaaggccgccaagctcgctgcaaagaag
gctgccgaaaaggccgccaagcaagctaagaagaacaagaagggcaagaactaa

DBGET integrated database retrieval system