KEGG   Aerococcus urinae CCUG36881: AWM73_01255Help
Entry
AWM73_01255       CDS       T04528                                 

Definition
(GenBank) hypothetical protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
aun  Aerococcus urinae CCUG36881
Pathway
aun00860  Porphyrin and chlorophyll metabolism
aun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AWM73_01255
Enzymes [BR:aun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     AWM73_01255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AMB95222
UniProt: A0A0X8FDB9
Position
284888..285538
Genome map
AA seq 216 aa AA seqDB search
MELYLARHGQSVRNVDGQFYGRLDPHLTPLGQQQAQALGQALSGKRIDRLVTSRMQRTQE
TAQIIADSLKAENNFQAFPWTQEADLNERDLGVWEGKTAQEIEALDPKTWWEYIDQPFLT
TPAEAESYFAFRDRVLRALFRVFSSASDEGSYFLLGHHGWLRLLVSRLLNLEVKYFDCHF
TQGKIYRYAIDLTLFLDRLIEAIEEGDEGCQNMVEI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggagctttatttagcgcggcacggccaaagtgttcgcaatgttgacggtcaattttat
ggcagactggacccgcatttgaccccactgggacaacaacaagcccaggctttgggacag
gcactaagcggaaaaagaattgaccgtttagtaacctctaggatgcagcggacccaagaa
actgcccagattattgcagacagcttaaaagctgaaaataatttccaggcctttccctgg
acccaggaagctgatctgaatgaacgtgatttgggtgtctgggaaggcaaaacggcccaa
gaaattgaagccctggatcctaagacctggtgggaatatattgaccaaccctttcttact
actccagctgaggcagaaagctattttgcctttagagaccgggtcttaagggccttattt
agagtctttagctctgctagtgatgagggaagctattttttactggggcaccatgggtgg
ctgcgcttattggtcagccggctcttaaatttggaagtgaaatattttgattgtcacttt
acccagggaaagatttatcgctatgcgattgacctaactttatttttggaccggctaatc
gaggctattgaagagggggatgaaggatgccaaaacatggtggaaatttaa

DBGET integrated database retrieval system