KEGG   Aerococcus urinae CCUG36881: AWM73_02350Help
Entry
AWM73_02350       CDS       T04528                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aun  Aerococcus urinae CCUG36881
Pathway
aun00010  Glycolysis / Gluconeogenesis
aun00020  Citrate cycle (TCA cycle)
aun00620  Pyruvate metabolism
aun01100  Metabolic pathways
aun01110  Biosynthesis of secondary metabolites
aun01120  Microbial metabolism in diverse environments
aun01130  Biosynthesis of antibiotics
aun01200  Carbon metabolism
Module
aun_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWM73_02350
   00020 Citrate cycle (TCA cycle)
    AWM73_02350
   00620 Pyruvate metabolism
    AWM73_02350
Enzymes [BR:aun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AWM73_02350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 RnfC_N DUF2118 HlyD_3 GCV_H QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AMB95434
UniProt: A0A0X8FE23
Position
530560..531777
Genome map
AA seq 405 aa AA seqDB search
MATEVVMPTLGLTMTEGTIEQWYVKEGDEVSSGDVLATISSEKLSGDVEAPEAGTVIKIL
ADEGDTLKCKAAMAYIGEAGEVVEVEDSTEEASETEAESSSSSKESPKETSKDKTDSKAR
QGAVKGDRIFITPVARKLAEEKGYNIEDIPGTGGNGRITRRDVERYQPEAKPSQVATSQA
GQGLPGMRKTIAKRMVQSLQTTAQLTLHRKADVTQLSKLRQEIKSKADDGAALGWTTLIT
RAAVKALEETPEMNSWYHDGQWEQHEAVHIGMATAVADGLVVPVIRDAQGLSLSKLGEKI
NEVTSQAKAGQLPGELYSGSTFSITNMGGRGVEYFTPVINPPEAGILGLGAIQKELAFDE
NGEVVELSKFPLSLTFDHQLLDGDPAGAFLDLIVSYLENPYSLLL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagaagtagtaatgccaacattaggactcaccatgacagaaggaactatcgaa
caatggtatgttaaagaaggcgatgaagtttcttcaggggacgtcctagcaacgattagt
tcagaaaaattatctggtgatgtggaagccccagaagcaggaactgtgattaaaattcta
gctgatgaaggcgacaccctaaaatgtaaggctgccatggcttatattggggaagccggt
gaagtagtagaagttgaagactcaactgaagaggctagtgaaactgaagcagaatccagc
tccagtagcaaagaaagtccaaaagaaacaagcaaggataaaactgatagcaaagcacgc
caaggagccgttaagggcgaccgtatctttatcactcctgtagcccgtaaattagctgaa
gaaaaaggctataatatagaggacattccaggaacaggtggtaatggtcgaattacccgt
cgtgatgtcgaacgctatcaacctgaagctaaacctagccaagtggccactagtcaagct
ggccaaggtttaccaggtatgcggaagaccattgctaaacggatggtccaaagcttacaa
accactgcccaattgactttacatcgtaaggcagacgttacccaattaagcaagctgcgc
caagaaattaagtctaaagctgacgatggggcagcactaggctggaccaccttaattacc
cgggcagctgttaaggccttagaagagacgcctgaaatgaatagttggtatcatgacggt
caatgggagcaacacgaagcggttcatattggaatggcgaccgcagttgctgatggccta
gtggttcctgtcattagagatgcccaggggctcagtttaagtaagttaggtgaaaagatt
aatgaagtgactagccaagccaaggctggccaattaccaggggagctctattcagggtcg
accttctccattactaatatgggaggacgaggcgttgaatacttcaccccagtgatcaac
ccaccagaagcaggtattctgggtctaggcgccatccaaaaagaattagcctttgatgaa
aacggcgaagtggtagagttaagtaaattcccattaagtttaaccttcgaccatcaatta
ctagatggtgatccagctggcgctttcttagacctaattgtttcttatctagaaaatcct
tatagtttactgctataa

DBGET integrated database retrieval system