KEGG   Aerococcus urinae CCUG36881: AWM73_04105Help
Entry
AWM73_04105       CDS       T04528                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aun  Aerococcus urinae CCUG36881
Pathway
aun00071  Fatty acid degradation
aun00072  Synthesis and degradation of ketone bodies
aun00280  Valine, leucine and isoleucine degradation
aun00310  Lysine degradation
aun00362  Benzoate degradation
aun00380  Tryptophan metabolism
aun00620  Pyruvate metabolism
aun00630  Glyoxylate and dicarboxylate metabolism
aun00640  Propanoate metabolism
aun00650  Butanoate metabolism
aun00900  Terpenoid backbone biosynthesis
aun01100  Metabolic pathways
aun01110  Biosynthesis of secondary metabolites
aun01120  Microbial metabolism in diverse environments
aun01130  Biosynthesis of antibiotics
aun01200  Carbon metabolism
aun01212  Fatty acid metabolism
aun02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWM73_04105
   00630 Glyoxylate and dicarboxylate metabolism
    AWM73_04105
   00640 Propanoate metabolism
    AWM73_04105
   00650 Butanoate metabolism
    AWM73_04105
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AWM73_04105
   00072 Synthesis and degradation of ketone bodies
    AWM73_04105
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AWM73_04105
   00310 Lysine degradation
    AWM73_04105
   00380 Tryptophan metabolism
    AWM73_04105
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AWM73_04105
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AWM73_04105
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AWM73_04105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aun04147]
    AWM73_04105
Enzymes [BR:aun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AWM73_04105
Exosome [BR:aun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWM73_04105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AMB95739
UniProt: A0A120I9R3
Position
880227..881474
Genome map
AA seq 415 aa AA seqDB search
MLKAKNEEVVFVGAARTPVGAYLGDLKTVPVDELGVISLTEAAKRAGVAVEDIEEVIVGH
VTGSQTTNNLGNIIGIDAGVKNTATGMTINRICGSGIQSAVSAAQELLLSNKSIIAAGGV
ESLSRAPFYLPESVRYEGLKGGNKPLIDANLAGHSSASGKDSGVNHMGNTAENVARKYGI
TRERADQFAVESQRKAAEAMENGRFAQEIIPVEVKGRKGKVNVVEKDGHPRPGTSMESLA
KLRPAFEKDGIVTAGNASGLNDGGAFEIMTTKSVAEERGLEIMARVVDYQIAGCDPAYMG
LGPVQAIKDILARQEMDLKEDIDILEINEAFAAQTIGCLIELGIEEDTDFYKNHFNPHGG
AVALGHPLGMSGARIITSLLYEFKNHPEYRYAIASACIGGGQGIALLLENGYYQG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagctaaaaatgaagaagttgtttttgtcggtgccgcacggactcctgttggt
gcttacctaggcgacttaaagactgtaccagttgacgaattaggggtgatttctcttaca
gaagctgctaaacgtgctggtgttgccgttgaagacatcgaagaagttattgttggtcat
gtcactggatcacaaacaaccaataatttaggtaacattatcggaattgatgcaggcgta
aaaaatactgcaacaggtatgaccattaaccgcatttgtggatcaggtattcaatccgct
gtatcagctgcacaagaattactattatccaacaaaagtatcattgccgctggtggggta
gaatctctatctcgtgcacctttctatctaccagaatccgttcgttatgaggggttaaaa
ggaggcaacaaacctttaattgatgctaacttagcaggacacagctctgcttctggtaaa
gattctggtgttaaccacatggggaacactgcagaaaatgttgctcgtaaatacggaatt
actcgtgaacgcgctgaccaatttgcggtagaatcccaacgtaaagctgcagaagctatg
gaaaacggacgtttcgctcaagaaatcattccagtagaagttaaaggacgtaaggggaaa
gttaacgtcgtagaaaaagacggccatccacgtccaggaacatcgatggaatcattagct
aaattacgcccagcttttgaaaaagatggtattgttactgcaggtaatgcttctggatta
aatgatggtggtgcttttgaaattatgaccaccaaatcagttgctgaagaacgtggctta
gaaatcatggctcgcgtcgttgactaccaaattgctggttgtgaccctgcttacatggga
ttaggaccagttcaagccattaaagacattcttgcccgtcaagaaatggaccttaaagaa
gacattgatatcttagaaattaatgaagcctttgccgctcaaactattggttgtctgatc
gagcttggtattgaagaagatactgacttctacaagaatcatttcaacccacatggtggt
gcagttgctttaggtcacccattaggcatgtctggtgcacgtatcattacatccttattg
tatgaattcaagaaccatccagaataccgttatgcgattgcttcagcatgtatcggtggg
ggacaaggtattgctctcttacttgaaaatggttattaccaaggctaa

DBGET integrated database retrieval system