KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_1295Help
Entry
HMPREF9243_1295   CDS       T01447                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
Pathway
aur00010  Glycolysis / Gluconeogenesis
aur00051  Fructose and mannose metabolism
aur00562  Inositol phosphate metabolism
aur01100  Metabolic pathways
aur01110  Biosynthesis of secondary metabolites
aur01120  Microbial metabolism in diverse environments
aur01130  Biosynthesis of antibiotics
aur01200  Carbon metabolism
aur01230  Biosynthesis of amino acids
Module
aur_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aur_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9243_1295 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF9243_1295 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF9243_1295 (tpiA)
Enzymes [BR:aur01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF9243_1295 (tpiA)
Exosome [BR:aur04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF9243_1295 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF9243_1295 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF9243_1295 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Gp49 Leu_Phe_trans
Motif
Other DBs
NCBI-ProteinID: AEA01364
UniProt: F2I5C1
Position
complement(1322947..1323702)
Genome map
AA seq 251 aa AA seqDB search
MRQVLIAGNWKLNKTASEATDFIEDLKAKLSGKEKAEVLVCPPALYVQSLLSESQDTNIK
VGAQNCYYENSGAFTGEISPLALADLGASYVVIGHSERRELFNESDEDVAKKAKAIFDNG
MTPIICCGETLEQREEGIAKEWITGQIKAALKELSQEEIAKSVIAYEPIWAIGTGKTASP
EDAEEICSHIRDVVFEVAGQEASDAVRVLYGGSVKPANVKDILAQENIDGALVGGASLQV
DDFLALVNAAE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaagttttaattgccggaaactggaaattaaataaaaccgctagtgaagcaaca
gattttattgaagacttgaaagctaaattaagtggtaaggaaaaggctgaagttttggtt
tgcccaccagctctatacgttcaaagcttactctctgaaagtcaagacactaacattaaa
gttggtgctcaaaactgctactatgaaaatagtggggctttcactggagaaatttcacct
ttagctttagcagatctaggagcgagctacgtggttatcggccactctgaacgtcgggaa
ttatttaacgaaagcgatgaagatgttgctaagaaagctaaagcaatcttcgataatggt
atgacaccaattatttgttgtggtgaaaccttagagcaacgtgaagaaggtattgccaaa
gaatggatcactggacaaatcaaggcagccttaaaagaacttagccaagaagaaattgct
aaaagtgtcattgcttatgaacctatctgggcaattggtaccggtaaaaccgcctctcca
gaagacgctgaagaaatttgtagccacattcgtgacgttgtctttgaagtagctggtcaa
gaagctagtgacgctgttcgtgtcctctacggtggttcagtgaaacctgctaatgttaaa
gatatcttagcccaagaaaatattgatggtgccctagtagggggagctagtcttcaagtt
gacgattttcttgctttagttaatgctgcagaataa

DBGET integrated database retrieval system