KEGG   Aurantimicrobium sp. MWH-Uga1: AURUGA1_00338Help
Entry
AURUGA1_00338     CDS       T05539                                 

Gene name
metG
Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
auw  Aurantimicrobium sp. MWH-Uga1
Pathway
auw00450  Selenocompound metabolism
auw00970  Aminoacyl-tRNA biosynthesis
auw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:auw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AURUGA1_00338 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AURUGA1_00338 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:auw01007]
    AURUGA1_00338 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:auw03016]
    AURUGA1_00338 (metG)
Enzymes [BR:auw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AURUGA1_00338 (metG)
Amino acid related enzymes [BR:auw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AURUGA1_00338 (metG)
Transfer RNA biogenesis [BR:auw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AURUGA1_00338 (metG)
 Prokaryotic type
   Other AARSs
    AURUGA1_00338 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AXE54047
UniProt: A0A344W1G0
Position
323536..325116
Genome map
AA seq 526 aa AA seqDB search
MSAGKSFYVTTPIFYVNDVPHIGHAYTEVAADVLARWHRQAGDRTWMLTGTDEHGEKILR
TATANGATPQEWVDRLVESAWKPLLDTIDISNDDFIRTTDARHEDNVKKFLQHLYDAGFI
YTGEYEGSYCVGCEEYKQDSDLVEGTGEFAGEKVCAIHSKPVENLHEKNYFFRMSDFTQP
LLDMYEANPNFVQPESARNEVVQFVKQGLNDLSISRSSFDWGIKLPWDESHVVYVWFDAL
LNYITAAGYGYDEEKLASLWPATHIVGKDILRFHAVIWPAMLMAAGVEVPHQVYGHGWLL
VGGEKMSKSKLTGIAPNDITDTFGSDAFRYYFMSAISFGQDGSFSWEDLSARYQAELANG
FGNLASRTLAMVTRYFDGVVPAAGELTPSDKAIVDVVAASVAEADAAIERLAIHEAVAAI
WSIVDALNGYITEQEPWALAKDPAQAERLATVLNTATEGLRALAVLLSPFMPQTTQKLWN
ALGVEGSLGALTAQPIREAGSWNQIPGGTTVGTLEALFPRIESAAE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccggcaaaagcttttatgtaaccacgcctatcttctacgtgaacgacgtgccc
cacattggtcacgcctacaccgaggttgctgctgacgtgctcgcacgctggcaccgccag
gctggagaccgtacctggatgctcaccggtactgacgagcacggtgaaaagatcttgcgg
accgcaaccgctaacggggcaacgccgcaggaatgggtcgaccgtttagtggagtctgcc
tggaagcctctgttggacaccatcgacatttccaacgatgacttcattcgcaccaccgat
gctcgccacgaagataacgtcaagaagttccttcagcatctgtatgacgctgggtttatc
tacaccggtgaatacgaaggttcttactgtgttggatgtgaagaatacaagcaggattca
gacctcgtagagggcaccggtgaattcgcgggtgagaaggtctgtgctattcactccaag
ccggtagaaaacctgcacgagaaaaactacttcttccgcatgagtgatttcactcagcct
ttgctcgacatgtatgaagcaaaccccaactttgtgcagccagagtctgcgcgcaacgag
gttgtgcagtttgtgaagcagggtctgaacgacctttccatttcacgctcgagcttcgac
tggggaatcaagcttccctgggatgaatcccatgttgtgtacgtatggttcgatgccctg
ctgaactacatcacggcagctggctatggctatgacgaagagaaactggcgtcgctgtgg
ccggcaactcacatcgtgggtaaggacatcctgcgcttccacgcagtgatctggccagca
atgttgatggctgccggtgtcgaagtaccgcaccaggtttatggacacggttggctgctt
gttggtggcgaaaagatgtctaagtccaaactcaccggtattgcacccaacgacatcact
gacacttttggttctgatgcgttccgctactacttcatgagtgccatcagctttggtcag
gatggctccttcagctgggaagacctctctgctcgttaccaagcagagctggcaaatggt
ttcggtaacctcgcctcacgcacactagctatggtcacgcgctactttgatggtgttgtt
cctgcagcaggtgagctcacaccttcggataaagccatcgtggatgttgtcgctgcttct
gttgcagaagcagacgctgcaattgagcgacttgccattcacgaagccgtggccgcgatc
tggtctatcgttgatgccctcaacggttacatcaccgaacaggagccatgggctcttgcc
aaagatcctgctcaggcagaacgtttagccacggtgctcaacactgcgactgaaggtttg
cgggcacttgctgtcctgctttctccctttatgcctcagacaacccagaaactgtggaac
gctcttggtgttgaaggtagcctcggtgcactgactgcacagcctattcgtgaggctgga
agctggaaccagattcctgggggaacaaccgtcggaactctggaagcactcttcccccgc
attgagtcggctgctgagtaa

DBGET integrated database retrieval system