KEGG   Aurantimicrobium sp. MWH-Uga1: AURUGA1_00926Help
Entry
AURUGA1_00926     CDS       T05539                                 

Gene name
glnE
Definition
(GenBank) Glutamate-ammonia-ligase adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
auw  Aurantimicrobium sp. MWH-Uga1
Brite
KEGG Orthology (KO) [BR:auw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AURUGA1_00926 (glnE)
Enzymes [BR:auw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     AURUGA1_00926 (glnE)
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     AURUGA1_00926 (glnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294_C
Motif
Other DBs
NCBI-ProteinID: AXE54612
UniProt: A0A344W325
Position
complement(916638..919607)
Genome map
AA seq 989 aa AA seqDB search
MALSRTQLAKAGFTELSEALECVDSVVAITGAQPELILSAVSSSADPDRALTWLVRLGQT
HSASTVLKKILRQEEATTRLLNILGGSRGLAEFIERHPQTLNVFLKEPQLPGDQEKLRAS
LLDSVQATKSIAGLTADQARDALRIRYREHLLAIALWDLNHKDPLSQIEVITGALSDIAG
AALEAGLAVARAEVAGQFSADEVALVDLAIIGMGKCGARELNYLSDVDVIYVARSRDEAA
LSTDQALTIATRLAQHTARSIYEVSKEPGLWEVDANLRPEGKDGALVRTLESHMAYYDRW
AKDWEFQALLKARPLAGSLELGEQYIASVAPKVWSSANRSNFVEQVQRMRERVTENIPGD
DVEYQIKLGPGGLRDIEFTVQLLQLVHGLVDDTVHTRGTLESLQRLSQAGYVGRDEAQSF
AADYRFLRLLEHRMQLRDLTRTHLMPRDEAEQRVLARATGLWNTAAEVVANWQQTKLEVR
ELHERLFYRPLLAAVAKLPEETHQLTSDQAEARLAAIGFRDPRGSLKHIAALTSGVSRRA
AIQRALLPVMLQWLSEGANPDHGLLSFRLLSEQLGESHWFLRMLRDSAGAAQRLTQVLSG
SRYVSDLMELIPESAAWFDGDEELQPTTEEVLSAEVLSILARHHEDDEAARKAVRSMRRR
EVLRLAIGGILNVLTIDQISQGLSDVTTAALSGYLGIALRESQHNPEFVVIAMGRYGGQE
LGFDSDADVIYVYRGTPECDGEVAQKRAERIILRIKELAEDPRLPFDIDTDLRPEGKNGA
IARSLDSYAAYYARWSLMWEAQALLRARAVLGPEQLQSDMMELINSVRYPAEISIDDVRE
IRRIKARVEAERLPQGADPSRHVKLGRGSLSDVEWTVQLLQLQYAHQFPQLQTTSSVSAL
RVAAEEQLISQDDASKLIEAWIFASRVRSGITIWADKATDVLPQDTRDLEGIARLLNYPP
GSASRLEEDYLSITRRSRQVVERVFFDFS
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
gtggcactgtcgcgcactcagctcgcaaaggctggtttcactgaactcagtgaagcgttg
gagtgcgtcgactcggtggttgcaatcacaggtgcgcaacctgagctcattctttcagca
gtttcttcaagcgctgatcccgatagagcattaacctggcttgtccggcttggacaaact
cattctgcttcgactgtgctgaagaagattctgaggcaagaagaagccaccactcgctta
ctaaacatcttgggtggttctcgtgggcttgcagagtttattgagagacatccgcaaacc
ctgaatgtctttttgaaagaaccccagctacctggggatcaggaaaagcttcgggcttct
ctgttagacagtgttcaagccaccaaatcaattgcagggcttacggcagatcaagcacgc
gatgcactgcgtattcgctaccgggaacacttgctggctattgcgctctgggacctcaac
cataaagacccgctttcacaaattgaggtcatcactggcgcactgtcagatattgcagga
gcagcattggaagctggccttgctgtagctcgggctgaagtagccgggcagttcagtgcc
gatgaggttgctcttgttgatctggccatcatcggtatgggtaagtgcggtgctcgagaa
ctgaactatctcagcgatgtcgatgtcatttatgttgcccgctcacgtgacgaggcagct
ttgtcaacagaccaggcgttgaccattgctacacgtctggctcagcacaccgctcgaagc
atctatgaagtttccaaagaacctggcttgtgggaagtagatgccaacttgcgtccggag
ggtaaggacggtgctcttgttcgaactctcgagtcacatatggcctactacgaccgttgg
gcgaaagactgggaattccaggctctcctcaaagcaagaccgctggctggcagtctagaa
ctgggagagcaatacattgcaagcgttgcacctaaggtttggtcaagtgcaaaccggtca
aactttgtcgaacaagtacagcgcatgcgcgaaagagtcaccgagaatattcctggtgac
gatgtggagtatcaaatcaaactcggtccaggtggccttcgggatattgaatttactgtt
caattactccaactcgtacacggccttgttgatgacactgttcacactcgtggcacccta
gagtcgctccaacgcctgtcacaggctggttatgtcggtcgagacgaagcacaaagcttt
gcagctgattatcggttcttgcgtttgttagaacatcgcatgcaattacgagatctgact
cgaacacacctcatgccccgagatgaagcagaacagcgtgtattagctcgagctactggc
ttgtggaacacggccgcagaagttgtcgccaattggcaacaaaccaaactcgaagtccgt
gaactccatgagcgtctcttctaccggcccttgcttgctgcagtagcgaagctgcctgaa
gaaactcaccagctcacgagtgaccaagctgaagctcgtcttgctgctattggattcaga
gatccaagggggtcactgaaacacatagccgcactcacatctggtgtctccagacgtgca
gcgattcaacgcgcattacttccggtcatgttgcaatggctttccgaaggcgcaaatcca
gatcatggcctgttgagtttccgattgctgagtgaacaattaggagagtcgcactggttc
cttcgtatgctgcgagattctgcaggtgcggcacaacgcctcacacaagtcctcagcggg
tcacgttacgtctccgatctgatggaactcatacctgaatcagcagcctggtttgatggt
gatgaagaattgcagccgaccacggaagaagtacttagtgcggaagtgctatcaatcttg
gcccgccaccacgaggacgatgaagccgcccgtaaagctgtgcgatcaatgcgtcgccgt
gaagtattacgtttagcaattggcggaattctcaacgtcctcaccattgaccagataagc
caaggcctcagtgacgtcactaccgctgcgttaagcggatacttaggcatcgcactgcgg
gaatctcagcacaatccagagtttgtcgtgattgcgatggggcgttacggagggcaagaa
ctcggcttcgatagcgatgctgacgtgatttatgtttatcgcggtacaccagagtgtgac
ggggaggtggcccagaaacgtgctgaacggatcattcttcgaattaaggagctagcagaa
gacccaagactgccattcgacattgatacggatctccgccccgagggaaagaatggagcc
attgcgcgttctctggactcctacgccgcatactacgcgcgatggtctctaatgtgggaa
gcgcaagccttgttgcgagcacgcgccgttctcggtcctgaacaacttcaatcagacatg
atggagctgatcaacagtgttcgttatcccgcggaaatcagcatcgatgatgtccgcgaa
ataaggcgtatcaaagcgcgcgtggaggcagaacgtttgccacagggcgctgatccttca
cgtcatgtgaaattaggtcgtggatcactgagtgatgttgagtggacggtccaattactc
caacttcagtatgcacatcagttcccccaattgcagaccacctcttcggtcagtgcactt
cgggttgccgccgaagaacaactcatttcacaagatgatgcctcaaagctcatcgaggca
tggatatttgcttcacgggtgaggtctggaattactatttgggccgataaagctaccgac
gtgctgccccaagacactcgagacctagaaggcattgcccgactattgaattatccgcca
ggatccgcaagccgcctcgaagaggattacctttccattactcggcgatctcgccaggtt
gtagaacgcgtgttttttgatttttcttag

DBGET integrated database retrieval system