KEGG   Trichormus variabilis: Ava_1747Help
Entry
Ava_1747          CDS       T00277                                 

Definition
(GenBank) Thioredoxin-related protein
  KO
K01829  protein disulfide-isomerase [EC:5.3.4.1]
K03671  thioredoxin 1
Organism
ava  Trichormus variabilis
Brite
Enzymes [BR:ava01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Ava_1747
Chaperones and folding catalysts [BR:ava03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Ava_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_8 Thioredoxin_2 Thioredoxin_9 Thioredoxin_7 TraF AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABA21369
CyanoBase: Ava_1747
CYORF: Ava_1747
UniProt: Q3MCB7
Position
complement(2180756..2181142)
Genome map
AA seq 128 aa AA seqDB search
MVLSVSERTFTQEVLESPVPVLVNFEAPWCGLCRIIHPLLLQFQSQCGEQIKLVGVNADE
NFKLSNTYRLKSLPTLLLIENGIIRHRLEGFRGRDDLRLALEEIRLSYTNRPKAYSSSKT
ADLECRTA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgtcggttagtgagcggacatttactcaagaagttttagaatctccggttccg
gttttagtaaattttgaagcaccctggtgtgggttgtgtcgcattatccaccctttgtta
ttacaatttcaatctcaatgcggcgaacaaattaaactagttggggtgaacgctgacgag
aatttcaaactttctaacacttatcgtttaaagtctttgcccacgttacttttgattgaa
aatgggatcattcgccatcgtctagaagggtttcgcggcagagatgacttacgattggcg
ttggaagaaatcagactcagttataccaaccgccctaaagcctacagtagctctaaaacg
gcagacttagaatgtcggacagcgtga

DBGET integrated database retrieval system