KEGG   Trichormus variabilis: Ava_1911Help
Entry
Ava_1911          CDS       T00277                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ava  Trichormus variabilis
Pathway
ava00260  Glycine, serine and threonine metabolism
ava00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01130  Biosynthesis of antibiotics
ava01230  Biosynthesis of amino acids
Module
ava_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ava_1911
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ava_1911
Enzymes [BR:ava01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ava_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
NCBI-ProteinID: ABA21533
CyanoBase: Ava_1911
CYORF: Ava_1911
UniProt: Q3MBV3
Position
2373469..2374710
Genome map
AA seq 413 aa AA seqDB search
MTTTPLSPSTPSNAQVPDIQGRFGRFGGKYVPETLMPALAELETAYQKYRHDPGFQAELQ
QLLRDYVGRATPLYFAERLTAHYARPDGTGAQIYLKREDLNHTGAHKINNALGQVLLAKR
MGKQRIIAETGAGQHGVATATVCARFGLECVIYMGVHDMERQALNVFRMRLMGAEVRPVE
AGTGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGQETRAQALEKW
GGLPDILLACVGGGSNAMGLFYEFVNESSIRLIGVEAAGEGVNTEKHAATLTKGRVGVLH
GAMSYLLQDEDGQVIEAHSISAGLDYPGVGPEHSYLKDVGRAEYYSVTDEQALAAFQRLS
RLEGIIPALETAHAIAYLETLCPQLDGSPRIIINCSGRGDKDVQTVAKFLIPQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgactaccactcccctttctccaagtaccccctcaaatgctcaggttcccgatatccaa
ggacgctttggacgctttggcggtaagtatgtgccggaaaccttgatgccggctttggct
gaattagaaacagcttatcaaaaataccgccatgaccctggttttcaagcagaactgcaa
caattattacgggactacgtaggacgtgcgacaccgttgtattttgcagaacgcctcact
gcccattatgcccgaccagatggtacaggagcgcaaatttacttaaaacgcgaagattta
aatcatacaggtgctcataaaattaataacgcccttggtcaagtattattagccaagcgc
atgggtaagcagcgcattattgccgaaaccggtgctggacaacatggtgtagcaacggct
acagtttgcgctcggtttgggttggaatgtgtgatttatatgggtgttcacgatatggaa
cgccaagctttgaatgtgtttagaatgcggctgatgggggctgaagttcgtccagtagag
gctgggactggaactctcaaggacgctacatctgaggcaattcgggattgggtgacgaat
gtggaaactactcactacattttgggttccgtcgccgggcctcatccttacccaatgatg
gtacgggattttcatgcagtcattgggcaagaaactcgcgctcaagctttggaaaaatgg
ggtggtttacccgatattctcttggcttgtgtgggtggcgggtctaatgcgatgggctta
ttttacgagtttgtgaatgagtcatccattaggttaattggagtagaagcagctggggaa
ggtgtcaatacagaaaagcacgctgccaccttgacaaaagggcgcgttggtgtattacac
ggggcgatgagttatctgctgcaagatgaggatggccaggtaattgaagcgcactcgatt
agcgcggggttagattaccctggtgtggggccagaacacagctatttgaaggatgttggt
cgtgcagaatattacagtgtgacggatgagcaagctttggctgcgttccagcgattatcc
cgcttggaaggaattatcccagccctggaaacagcccatgcgatcgcctacttagaaacc
ctctgtcctcaacttgacggtagcccccgcattattatcaactgctctggacgcggtgat
aaagatgtccaaactgtagctaagtttttaatcccacaataa

DBGET integrated database retrieval system