KEGG   Trichormus variabilis: Ava_1946Help
Entry
Ava_1946          CDS       T00277                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ava  Trichormus variabilis
Pathway
ava00860  Porphyrin and chlorophyll metabolism
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ava_1946
Enzymes [BR:ava01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ava_1946
Exosome [BR:ava04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ava_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABA21568
CyanoBase: Ava_1946
CYORF: Ava_1946
UniProt: Q3MBR8
Position
2420860..2421870
Genome map
AA seq 336 aa AA seqDB search
MSVENPSTAKPLNLLQRPRRLRRTVTLRRMVRETTLTVDDLIYPMFVMEGEGQKVEIASM
PGCYRYSLDLLLKEIAEVSQLGIKAIALFPVISENKKDDIGAESYNPDGLVQQTVKAIKQ
AVPDIVIITDVALDPFTTHGHDGLVAENGTILNDPTVEVLVKMALSQAAAGTDFVAPSDM
MDGRIGAIRQALDAEGYVHVGILAYSAKYASAYYGPFRDALDSAPKFGDKKTYQMDAANA
REAIKEVELDIAEGADIVMVKPALAYLDIIYQVRQATQLPVAAYNVSGEYAMIKAAAQMG
WIDEKQVILESLTSMKRAGADLILTYFAREVALMLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgaaaatccatctaccgccaaaccattgaacctgcttcaacgcccccgtcgg
ttgcgtcggactgtaacactgaggcggatggtgcgggaaactaccctgacagtggatgat
ttgatttatccgatgtttgtcatggaaggagaggggcaaaaagtagaaattgcttctatg
cctggatgttatcgttactccctagatttgttgctcaaagagatagccgaagtatcacag
ctaggaattaaggcgatcgcacttttccctgtcatctccgaaaataaaaaagatgatatc
ggtgcagaaagttacaatccagatgggttagtacagcaaacagtcaaagccattaaacaa
gcagttcccgacattgttattatcaccgacgtagcccttgaccccttcaccacacatgga
catgatggtttagttgctgaaaacggcacaatcttaaatgaccccactgtggaagtgtta
gtgaaaatggcactttcccaagccgccgccggtacagattttgtcgccccttccgacatg
atggatggcagaattggcgcaatccgtcaagccttagatgcagaaggctacgttcatgta
ggaattttggcatactccgctaaatacgcctctgcctattacggcccctttcgagatgcg
ttagattctgcccccaaatttggcgacaaaaagacttatcaaatggacgcagccaacgct
agagaagcaattaaagaagtagaactagatattgccgaaggtgcagatattgttatggta
aaacctgccctggcatatctagatatcatttatcaagtccgtcaagccacccagttacca
gttgcagcctacaacgtcagtggcgaatatgccatgatcaaagctgcggctcaaatgggt
tggattgatgaaaaacaagtgattttggaatctttaaccagcatgaaacgcgccggcgca
gatttaattctcacctactttgccagagaagtagcactgatgttgctttaa

DBGET integrated database retrieval system