KEGG   Trichormus variabilis: Ava_2149Help
Entry
Ava_2149          CDS       T00277                                 

Definition
(GenBank) Response Regulator Receiver Signal Transduction Histidine Kinase
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c HisKA HATPase_c_5 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ABA21769
CyanoBase: Ava_2149
CYORF: Ava_2149
UniProt: Q3MB67
Position
2659158..2660381
Genome map
AA seq 407 aa AA seqDB search
MSSPINNSVLIVDDIPTNIKVLFDILNQAGFRVSVAKNGLSALAKVQETLPNLILLDVMM
PGMDGFETCRHLKANPKTKDIPVIFMTALSDTVNKVKGLQIGAVDYITKPIEYEEVLARI
NVHLELRRTQLKLAQEEKMSSLGQLVAGIAHEINNPVNFIYGNLTHAQNYVGDLLNLLKL
YENHTVNPSPEIQAFSKSIELEFIKQDLPHLLSSMQMGTERVEKIVRSLRLFSRLEDPEF
QLFNLHEGIDSTLIILSHRLKILPTDSTIHIIKEYGDIPLVECYSGKLNQVFMNLLANAI
DALEESVVNRETTDTLTIWIRTTVVDDQKSVLIEITDNGVGIPLEVQQRIFEQFFTTKPL
GKGTGLGLAIAHEIIVEKHGGTLQVQSTPGKGTQFLITIPIQQVIRY
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcccataaataactcagtcttaattgtagatgatatcccgactaacatcaag
gttttgtttgacattctcaatcaagctggttttcgagtttctgttgctaaaaatggtcta
agcgcgttagcaaaagtacaagaaacattaccaaatttaattttactggatgtcatgatg
cctggtatggatggatttgaaacttgccgccacctaaaagccaatcccaagaccaaggac
attcccgtaatttttatgacagctttatctgatacggtaaataaagtcaaagggttgcaa
attggtgcagttgactatattactaaacctattgaatatgaagaagtgttagcgagaatc
aatgtccatttagaattgcggcggactcaattaaagctagcacaagaggagaaaatgtct
tctttgggacagttagtggcaggaattgcccatgaaattaataatccagttaatttcatt
tatgggaatttaacccacgcccaaaattatgttggagacttattaaatttattaaaatta
tacgaaaatcatacggttaatccaagtccggaaattcaagcattctccaaaagtattgaa
ttagagtttattaaacaagatttaccacatctattatcttcgatgcagatggggactgaa
agggtggagaaaatcgtgcgatcgctgcggttattctctcgattagaagacccagaattt
caactatttaacttacatgagggtattgatagcacactcattattttaagtcaccgcctc
aaaattttgcctacagattcaactattcatattatcaaggaatatggtgatattcctttg
gttgagtgctattctggaaaacttaaccaagtattcatgaatctgctggctaatgccatt
gatgccttagaagagtcagtagttaatagagaaacaactgatacattgacaatttggatt
cggacaacagtcgtggatgaccaaaaatcagtattaattgaaattacagataatggtgtt
ggtattcctctagaagtgcaacagcgtatatttgagcaatttttcactaccaagccttta
ggtaaaggtacaggtttaggattggcgatcgcccatgagattatagtcgaaaaacatggg
ggtactctacaggtacaatctactccgggaaaaggtactcaatttttaatcactattccc
attcaacaagtgattagatattaa

DBGET integrated database retrieval system