KEGG   Trichormus variabilis: Ava_2470Help
Entry
Ava_2470          CDS       T00277                                 

Definition
(GenBank) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
ava  Trichormus variabilis
Pathway
ava00230  Purine metabolism
ava01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Ava_2470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ava04147]
    Ava_2470
Enzymes [BR:ava01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     Ava_2470
Exosome [BR:ava04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ava_2470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Motif
Other DBs
NCBI-ProteinID: ABA22085
CyanoBase: Ava_2470
CYORF: Ava_2470
UniProt: Q3MAA1
Position
complement(3064957..3065475)
Genome map
AA seq 172 aa AA seqDB search
MDLKSLIRDIPDFPKPGILFRDITTLLRDRQGLRYTIDFLAEKCFEANLDIDYVIGMESR
GFIFGTPLAYKLGAGFIPVRKKGKLPAAVHSIEYELEYGTDCLEVHRDALHPDSRVLIVD
DLIATGGTASATAKLVQQIGCELVGFGFIIELRDLQGRKHLPDVPIISLVEY
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaatctctcattcgtgacatccctgattttcctaagcccggaattttattt
cgagatatcactactctactgcgcgatcgccaaggattacgatatactattgacttttta
gcggaaaaatgctttgaagcaaacttagatatagattacgttattggtatggagtcacgg
gggtttatttttggtactcccttagcctataaattaggggctggttttattcctgtccgc
aaaaaaggcaagttacccgcagcagttcactcgattgaatatgaactagagtatggcact
gactgtttagaagtgcatcgggatgctttacatccagatagtcgagtattaattgtagat
gatttaattgccacaggtggcacagccagcgccacagccaaactagtgcagcaaatcggc
tgcgaattagtggggtttgggtttattatcgagctacgggatttacaagggcgaaaacat
ctgcctgatgtacccattatttccttagtggaatattag

DBGET integrated database retrieval system