KEGG   Trichormus variabilis: Ava_2479Help
Entry
Ava_2479          CDS       T00277                                 

Definition
(GenBank) phosphate ABC transporter membrane protein 2, PhoT family
  KO
K02038  phosphate transport system permease protein
Organism
ava  Trichormus variabilis
Pathway
ava02010  ABC transporters
Module
ava_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:ava00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Ava_2479
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ava02000]
    Ava_2479
Transporters [BR:ava02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    Ava_2479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABA22094
CyanoBase: Ava_2479
CYORF: Ava_2479
UniProt: Q3MA92
Position
3075920..3076801
Genome map
AA seq 293 aa AA seqDB search
MNADFPERSLTRAPMSGRTLFNTMMTGVAFLCGALALLPLLAVLSYVIIKGFSSLNLSIF
TELPPAPLRQGGGFGNAILGTLLMVGIGALISIPLGVIAAIYLTEFSSGKLARWIRFATN
VLSGVPSIIAGVFAYGIIVLTLVKLNLGSYSAIGGGFALAILMLPIIVRTTDEALQLVSQ
DLRQASVGLGATNFQTVTQVVLPAALPAIVTGSTLAIARAAGETAPLLFTALFSPFWPNS
LFKPTASLAVLVYNFAISPFKNWQSLAWAASLILVLMVLITSIIARWATRQKA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgattttcctgaaaggagtttaactcgcgcccccatgtctggacggacgctg
tttaatacgatgatgacaggagtagcattcctgtgtggagcattagctctgttgccgcta
ttggcagtactatcttatgtcatcattaaaggttttagtagtctcaatctaagtatattt
acagaattgccgcccgcacctctaagacagggaggaggttttggtaatgccattttgggt
acactattaatggtaggaattggtgcattaattagtattccattaggtgtaatagcggca
atttatttaacagagtttagctctggtaaactagccagatggattaggtttgctactaat
gtcctgagcggagttccttctattattgctggtgtatttgcttatgggattatagttctg
acattggtaaagctgaatttaggttcttattcagctattggcgggggatttgcattagca
atcttaatgctgccaattattgtgagaactactgacgaagctttacagctagtttcgcaa
gatttgcgccaagcatctgtaggtttgggagctactaattttcaaacagtaacacaagtt
gtcttgccagctgctttaccggcaattgtcacaggatcaacattggcgatcgcccgtgct
gctggagaaactgcacctttattgtttactgccttattttcaccattctggcctaatagc
ttatttaaacccacagcttcgctggctgttttggtttacaactttgccatttctccgttt
aaaaattggcagtcactagcctgggctgcatctttgattttggtgttgatggttctcatc
accagtatcattgctcgctgggcaactcgtcaaaaagcttag

DBGET integrated database retrieval system