KEGG   Trichormus variabilis: Ava_2486Help
Entry
Ava_2486          CDS       T00277                                 

Definition
(GenBank) transposase, IS4 family
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1_2 DDE_Tnp_1
Motif
Other DBs
NCBI-ProteinID: ABA22101
CyanoBase: Ava_2486
CYORF: Ava_2486
UniProt: Q3MA85
Position
complement(3082253..3082642)
Genome map
AA seq 129 aa AA seqDB search
MVDSLGLLLKVVVSEANAPERVLAAYALMELLEERPELLEKVKVMWVDSGYDGDKFALCV
WLMIQAHVEVIRRTEQEFQVLPKRWVVERTFGWFNQYHRLSKDYERLTEMSEAAIYAVMT
RIMLRRLVS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
ttggttgatagtctaggacttttgttaaaagtcgttgtcagtgaagcaaacgccccagaa
cgagtacttgctgcttacgcactcatggaattgctagaagaacgcccggaattactggaa
aaagttaaagttatgtgggttgattctggttacgacggtgataaatttgcactctgtgtt
tggttgatgatccaagctcatgttgaagtcatacggcgtactgaacaagaatttcaagtt
ttgcctaaacgttgggtagtagaaagaacatttgggtggtttaaccaataccatcgtctt
agtaaagattatgagcgtcttaccgaaatgagcgaagcagccatatatgctgttatgact
agaattatgctacgtcgtcttgtctcctaa

DBGET integrated database retrieval system