KEGG   Trichormus variabilis: Ava_2492Help
Entry
Ava_2492          CDS       T00277                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ava  Trichormus variabilis
Pathway
ava00010  Glycolysis / Gluconeogenesis
ava00030  Pentose phosphate pathway
ava00051  Fructose and mannose metabolism
ava00680  Methane metabolism
ava00710  Carbon fixation in photosynthetic organisms
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01120  Microbial metabolism in diverse environments
ava01130  Biosynthesis of antibiotics
ava01200  Carbon metabolism
ava01230  Biosynthesis of amino acids
Module
ava_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ava_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
ava_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ava_2492
   00030 Pentose phosphate pathway
    Ava_2492
   00051 Fructose and mannose metabolism
    Ava_2492
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Ava_2492
   00680 Methane metabolism
    Ava_2492
Enzymes [BR:ava01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Ava_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ABA22107
CyanoBase: Ava_2492
CYORF: Ava_2492
UniProt: Q3MA79
Position
3088010..3089089
Genome map
AA seq 359 aa AA seqDB search
MALVPLRLLLDHAAENGYGIPAFNVNNLEQIQAILKAAAETDSPVILQASRGARNYAGEN
FLRHLILAAVETYPEIPIVMHQDHGNAPSTCYSAIKNNFTSVMMDGSLEADAKTPASFEY
NVNVTREVVNVAHALGVSVEGELGCLGSLETGAGEAEDGHGFEGTLDHSQLLTDPDEAVN
FVEATQVDALAVAIGTSHGAYKFTRKPTGEILAISRIEEIHRRLPNTHLVMHGSSSVPED
LIALINEYGGAIPETYGVPVEEIQKGIKSGVRKVNIDTDNRLAITAAVREALAKNPKEFD
PRHFLKPSITYMQKVCAERYVQFGTAGNASKIKQVSLETFAAKYAKGELNAISKSAAKV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgtaccattgcggctgcttttggatcacgcggctgaaaacggttacggcatc
ccagctttcaacgttaacaatttggagcagattcaggcaatcctgaaggctgctgccgag
acagatagccccgtaattttgcaagcttctcgtggcgctcgtaattatgcaggtgaaaac
ttcctccgccacctgatcttggctgcggtagaaacctatcctgagattcccatcgtcatg
caccaggatcatggtaatgctccttctacttgctactcagcaatcaagaacaacttcacc
agcgtcatgatggatggttctttggaagctgatgctaaaacccctgctagcttcgagtac
aacgtgaatgttacccgcgaagttgtaaatgtagctcatgctttgggcgtaagtgtagaa
ggtgaacttggttgtttgggttctctagaaaccggcgcaggtgaagctgaagacggacac
ggttttgaaggtactcttgaccattctcaactgttaactgaccccgatgaagctgttaac
ttcgtagaagcaacccaggtagatgctttggctgtagctatcggtactagccacggtgct
tacaagtttacccgcaaacccaccggcgaaattttggctatcagccgtattgaagaaatt
caccgccgtctgcctaacacccacttggtaatgcacggttcttcttccgtacctgaagat
ttaatcgctttgatcaacgagtacggtggtgctattcctgaaacctacggtgtacctgta
gaagaaatccaaaaaggtatcaagagtggtgttcgcaaagttaacatcgacactgacaac
cgtttggcaattactgcggctgtacgtgaagctttagccaaaaatcccaaggaatttgac
ccccgtcacttcctcaagccttctattacatatatgcagaaggtttgtgcagaacgctat
gtacaattcggtactgctggtaatgctagcaagattaagcaagtttctctagaaactttt
gctgctaagtatgctaaaggcgaattgaacgctatcagcaaatctgctgctaaggtttaa

DBGET integrated database retrieval system