KEGG   Trichormus variabilis: Ava_2495Help
Entry
Ava_2495          CDS       T00277                                 

Definition
(GenBank) hypothetical protein
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF559 MTES_1575 Transp_Tc5_C DUF3795
Motif
Other DBs
NCBI-ProteinID: ABA22110
CyanoBase: Ava_2495
CYORF: Ava_2495
UniProt: Q3MA76
Position
3089996..3090751
Genome map
AA seq 251 aa AA seqDB search
MNENIKPTPYVRRPNHIVKCAIPSCNNLGFRHDGCFKCGEYKCPKHLRTPIQGKEFNTEE
ISLFYNIDSNEGICAFCGNEPRKIVSVRAESTEGKEIEKEIYGEFVKLQQELSKNSLRKQ
YSLLLFERIRQNLSYIDSLESSPLEQRLWAELLARGLDDYIKPQIELYDNEGIYIVRADF
ASTWLKMAIFTDGITYHSSPQAQARDAEHNLRIQEMGWVVKRYVTEDIESKIEAVIEEIY
QLVCLKILQMS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaatataaaacctacgccatacgtaagaagaccaaatcatattgtaaagtgt
gcaattcccagttgtaataatctggggttcaggcatgatggctgctttaagtgtggtgag
tataaatgtccgaaacatttaagaacaccaatacaaggaaaagaatttaatacagaagaa
atatcattattttacaatattgattccaatgaaggaatttgtgcattctgcggaaatgaa
ccaagaaagatagtcagtgtcagagctgaaagtacggaagggaaagaaattgaaaaagaa
atttatggggaatttgtaaaattacagcaggagttaagcaaaaattcattgaggaaacaa
tattcactcttgttatttgaaagaatcaggcagaatttatcttatatcgattctttggaa
tccagcccattagaacaaaggctttgggctgaacttcttgcaaggggtttggatgattac
attaagccacaaattgaattatatgataacgaaggtatctatattgttcgggcagatttt
gcaagtacttggctaaaaatggctatttttacagatggtataacttatcattcttcacct
caagcccaagcgcgggacgcagagcataatctaagaatacaagagatgggatgggttgta
aaaagatatgtaacagaggatatagaatctaaaatagaagcagtaattgaggagatttat
cagttagtatgtttgaaaattttgcagatgagttaa

DBGET integrated database retrieval system