KEGG   Trichormus variabilis: Ava_2497Help
Entry
Ava_2497          CDS       T00277                                 

Definition
(GenBank) Plasmid stabilization system
  KO
K06218  mRNA interferase RelE/StbE
Organism
ava  Trichormus variabilis
Brite
KEGG Orthology (KO) [BR:ava00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:ava02048]
    Ava_2497
Prokaryotic defense system [BR:ava02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   RelE/StbE-RelB/StbD
    Ava_2497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParE_toxin ParE-like_toxin TUDOR
Motif
Other DBs
NCBI-ProteinID: ABA22112
CyanoBase: Ava_2497
CYORF: Ava_2497
UniProt: Q3MA74
Position
3091117..3091380
Genome map
AA seq 87 aa AA seqDB search
MIYQIEITTRAAKQLKKLSEDIKLKIEEKIQELSNNPRPNGVVKLEGEEDTYRVRVSKYR
ILYEIKDDLLIVKVVKVSHRRDVYRRK
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcaaatagaaattacaactagggcagctaaacaattaaaaaagctatctgaa
gatattaagcttaaaattgaggaaaaaattcaagagttatcaaacaatcctcgccctaat
ggcgttgttaagttagagggtgaagaagatacatatcgtgtccgtgtaagtaagtaccgt
atcttatacgagattaaagatgatttattaatagttaaagttgttaaagttagtcatcgt
agagatgtttatcgccgtaaatag

DBGET integrated database retrieval system