KEGG   Trichormus variabilis: Ava_2500Help
Entry
Ava_2500          CDS       T00277                                 

Definition
(GenBank) Rieske (2Fe-2S) region
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske
Motif
Other DBs
NCBI-ProteinID: ABA22115
CyanoBase: Ava_2500
CYORF: Ava_2500
UniProt: Q3MA71
Position
3094630..3095709
Genome map
AA seq 359 aa AA seqDB search
MDANSPHIKATHKPKIFNNSERFIEGWYWVIPSDNLGINEVKSITLLGRKLVIYRGQDYQ
VTICDAYCPHMGAHLGEGTVEGNELRCAFHHWKFNADGICVEIPCLDEPLSLKLKTWPTV
EKYGIIWIWTGEIPRESVPFVPELEFQDYEAVLGSSFVINCHPHLIMLNAIDTQYFQGVQ
VLDIGFEKQELNQNAIIFSKYKRQYHDLPFKKVFRPLYKNPIYSICYWYGSTVTLTVGTD
LRRCYLMLALRLIAGEQVEVQTIFFTKQRKGLLGWLFNRLMLWLSNSLVQELIRDERNIL
QNMQFNLKNPIKVDQSIVQLINHVEMQKPLMWKTWLLARSPETEVKETQTKWRDELTND
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaactctccgcatatcaaggctactcataaaccgaaaatttttaataattca
gaacgttttattgagggatggtattgggtaataccatctgataatttaggaataaatgaa
gtaaaatctatcactctcttaggtaggaaactagtaatttatcgcggacaagattaccaa
gtaactatttgtgatgcctattgtccacatatgggcgctcacttgggagaaggtactgtt
gaaggtaatgaattacgctgtgctttccatcactggaaatttaatgctgatggaatatgt
gtggagattccgtgtttagatgaacctctgtccctcaagttaaaaacttggccgacggtg
gagaagtacggaataatatggatttggactggagaaataccacgagaatctgtaccattc
gttccagagttagagtttcaggattacgaggctgttctcggttctagttttgtgataaat
tgccatcctcatctaattatgttgaatgctattgatactcaatattttcaaggagtccag
gttttagatattggctttgaaaaacaggaattaaatcaaaatgccattatttttagtaaa
tataaacgacaatatcatgatttgccgtttaaaaaagtctttcgtcctttatacaaaaat
cctatttatagtatttgctattggtatggtagtacagtcactttaaccgtaggaacagac
ttacgccgttgctatctgatgttagctttgcggttaattgcaggggaacaggtagaagta
caaactatattttttactaagcaacgtaaaggtcttttgggttggttatttaaccgtttg
atgttatggctgagtaattctttggtgcaggaattaatcagggatgagagaaacatttta
cagaatatgcagtttaatttaaaaaatcccatcaaagtagatcaatcgattgtgcaatta
atcaatcatgtggaaatgcaaaaacctttgatgtggaagacttggctgttagcgcgatcg
cctgagacagaggtaaaggaaactcagactaaatggcgagatgaattgactaacgattaa

DBGET integrated database retrieval system