KEGG   Trichormus variabilis: Ava_2511Help
Entry
Ava_2511          CDS       T00277                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
ava  Trichormus variabilis
Pathway
ava00790  Folate biosynthesis
ava01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ava_2511
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ava04147]
    Ava_2511
Enzymes [BR:ava01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Ava_2511
Exosome [BR:ava04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ava_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ABA22126
CyanoBase: Ava_2511
CYORF: Ava_2511
UniProt: Q3MA60
Position
complement(3105412..3105693)
Genome map
AA seq 93 aa AA seqDB search
MAQLLGDAEIQSQASKLSGWTLEGSKLQTTRKFKDFIEAIAFVNKLVEPAESAGHHPDIE
ISYNKVKVTLTTHDAGGLTQKDFDVAATISQIN
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaattactaggcgatgcagaaattcagtcacaagctagcaaactatctgggtgg
acgttagagggttctaagttgcagactacccgcaagttcaaagattttattgaggcgatc
gcatttgtcaataagttggtagaacctgcggagtcagctggacatcatccagatatagaa
atctcctacaacaaagtcaaagttacactaacaacccatgatgcaggtggtttgacacaa
aaagactttgatgtagcagcaacgatctcccaaatcaactaa

DBGET integrated database retrieval system