KEGG   Trichormus variabilis: Ava_2512Help
Entry
Ava_2512          CDS       T00277                                 

Definition
(GenBank) Photosystem II reaction centre protein PsbD/D2
  KO
K02706  photosystem II P680 reaction center D2 protein [EC:1.10.3.9]
Organism
ava  Trichormus variabilis
Pathway
ava00195  Photosynthesis
ava01100  Metabolic pathways
Module
ava_M00161  Photosystem II
ava_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    Ava_2512
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:ava00194]
    Ava_2512
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     Ava_2512
Photosynthesis proteins [BR:ava00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    Ava_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Photo_RC
Motif
Other DBs
NCBI-ProteinID: ABA22127
CyanoBase: Ava_2512
CYORF: Ava_2512
UniProt: Q3MA59
Position
complement(3106302..3107357)
Genome map
AA seq 351 aa AA seqDB search
MTIAVGRAPSRGWFDVLDDWLKRDRFVFVGWSGILLFPCAFLALGGWLTGTTFVTSWYTH
GLASSYLEGANFLTVAVSSPADSMGHSLLLLWGPEAQGDFTRWCQLGGLWPFVALHGAFG
LIGFMLRQFEIARLVGIRPYNALAFSAPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIFRF
LLFLQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFEDGEGANTFRAFNPTQSE
ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAVGIVGLALNLRAYDFVSQ
ELRAAEDPEFETFYTKNILLNEGIRAWMAPQDQPHEKFVFPEEVLPRGNAL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgcagtaggaagggcccccagtagagggtggtttgacgtactagacgactgg
ttaaagcgcgatcgcttcgtattcgtaggttggtcagggatattattatttccttgcgcc
ttcctagcactaggcggttggctaaccggtacaacatttgtcacatcgtggtacacccac
ggactagcatcatcctacctggaaggagcaaacttcctgacagtagcagtatcaagccca
gcagacagcatgggacactccctgttgttgttgtggggaccagaagcccaaggggacttt
acccgttggtgtcagctaggggggttatggccattcgtagccctacacggagccttcggt
ttgatcggattcatgctacgtcaatttgaaattgcgcgcctagtaggaatcagaccctac
aacgcactagcattttcagcacccatagcggtattcgtcagcgtattcctgatgtaccca
ttgggacaatcatcttggttctttgcaccaagctttggagtagcagcaatcttcagattc
ttgttattcctccaagggttccacaactggacactcaaccccttccacatgatgggagta
gcaggtgtactaggtggagcgctactgtgcgccatccacggtgcaacagtagaaaacacc
ttatttgaagacggcgaaggcgcaaacaccttccgcgccttcaaccccacccaatcagaa
gaaacctattcaatggtgacagcgaaccgattctggtcacagatattcgggattgctttc
tccaacaaacgctggttgcacttcttcatgttgttcgtacccgtcactgggttgtggatg
agtgcggtaggcatcgttggtttagcattgaacctgcgggcttatgacttcgtttcccaa
gaattacgggcagcagaagacccagaatttgaaaccttctataccaagaacattttgctg
aacgagggtatccgcgcttggatggctcctcaagatcagcctcacgaaaaatttgtattc
cccgaagaagtattacctcgcggtaatgctctctaa

DBGET integrated database retrieval system