KEGG   Trichormus variabilis: Ava_2514Help
Entry
Ava_2514          CDS       T00277                                 

Definition
(GenBank) ABC transporter-like protein
  KO
K16786  energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
ava  Trichormus variabilis
Pathway
ava02010  ABC transporters
Module
ava_M00582  Energy-coupling factor transport system
Brite
KEGG Orthology (KO) [BR:ava00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Ava_2514
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ava02000]
    Ava_2514
Enzymes [BR:ava01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Ava_2514
Transporters [BR:ava02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter [MD:M00582] [OT]
    Shared module
     Ava_2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N AAA_15 AAA_16 NACHT AAA_5 AAA_22 AAA_18 RsgA_GTPase AAA_23 Mg_chelatase AAA AAA_13 AAA_25 DUF3584 AAA_27 AAA_33 G-alpha
Motif
Other DBs
NCBI-ProteinID: ABA22129
CyanoBase: Ava_2514
CYORF: Ava_2514
UniProt: Q3MA57
Position
3108045..3108722
Genome map
AA seq 225 aa AA seqDB search
MADMGIVVKDLNFSWPNGETAIQSCSLEVPQGEFWMLLGTNGSGKSTLLRLLAGLLAPKS
GEIGVLHPVGFVFQNPDHQLVMPTVGADVAFGLVEEKLPTSAVRARVEEALGAVNLSALQ
LRPIYALSGGQKQRVAIAGAIARRCEVLLLDEPTALLDPDSQLDLVASVRRLVKSRGITA
LWVTHRLDELNYCDGAFLLEKGCLVDQGEPQRLKQRLMEVHQEAS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatgggcattgtcgttaaagatttaaatttcagttggccgaacggtgagaca
gcaattcaatcttgctctttggaagtaccccaaggagaattttggatgcttttgggtact
aatggcagtggcaaatctaccttactccgtctcctagcagggcttttggctcctaaatct
ggtgaaattggggttttacatcctgtgggttttgtcttccaaaaccctgatcatcaattg
gtgatgccaactgttggtgctgatgtggcttttggtttggtggaagaaaaactgccaaca
tcggctgtcagagcgagagtagaagaggcactgggggcagtgaatttgagtgctttacag
ctacgcccaatttacgccctgagtgggggacaaaagcagcgtgtggctattgctggagcg
atcgctcgtcgctgtgaagtcttattattagatgaacctacagccttacttgacccagat
agtcaactggacttagtggccagtgtccgccgcctagtgaaaagtaggggtatcacagct
ttgtgggtaacacaccgcttggatgaattgaattactgtgatggtgctttcttactggag
aaaggttgtttagtagatcaaggtgaaccccaacgcctcaaacaacgccttatggaagta
caccaagaagcttcttga

DBGET integrated database retrieval system