KEGG   Trichormus variabilis: Ava_2515Help
Entry
Ava_2515          CDS       T00277                                 

Definition
(GenBank) Protein of unknown function DUF901
  KO
K06962  uncharacterized protein
Organism
ava  Trichormus variabilis
Brite
KEGG Orthology (KO) [BR:ava00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Ava_2515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NYN_YacP
Motif
Other DBs
NCBI-ProteinID: ABA22130
CyanoBase: Ava_2515
CYORF: Ava_2515
UniProt: Q3MA56
Position
3109009..3109557
Genome map
AA seq 182 aa AA seqDB search
MPRSPIPAVLLVDGYNIIGAWPCLKKTRDKNGLEAARGQLVEAMTSYSSYQGYDTQIVFD
AHYQNTCSNKEIITELVSVYYTDFGQTADTYIEKICASLRPEVSQARISRVIVATSDRAQ
QLTVQGYGAEWLSAYQLCGEVETTVCRMRQKYQSRKQSKSRFLASTIDPQARQKLAELRM
GI
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgccccgttccccaatcccagccgttttattagtagacggctacaatataattggcgct
tggccttgtttgaaaaaaacccgtgataaaaatggactagaggctgctcgcgggcaactt
gtggaagcaatgacaagttacagctcgtatcagggttatgacactcaaatagtttttgat
gctcactatcaaaatacttgtagtaacaaagaaattattacagagctagtttcagtttat
tacacagattttgggcaaacagcagatacttatattgaaaaaatttgtgcttctttgcgc
cctgaagtttcgcaagctcgcatttctcgtgtaattgttgctacatcagaccgcgcacaa
cagttgacagtacagggatacggggctgaatggttatcagcatatcaactgtgcggcgaa
gtagaaactacagtgtgtaggatgcggcaaaagtatcaatctcgtaaacaatctaaaagc
aggtttctcgccagcaccattgatcctcaagcgcgtcaaaagctagctgaactacgaatg
gggatttaa

DBGET integrated database retrieval system